IKMC Project Report - NorCOMM (ID: 42584)

2410131K14Rik MGI:1924042 ENSMUSG00000032840 OTTMUSG00000028968
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000049138 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MLNLAALLWRRLLRKRWVLALVFGLSLVYFLSSTFKQAMSARGRTCWRMAVATSASPAQSSTAVMGAWPMAAVKPTSTAS
PAACSPASNFSWSASSTGQLWPSRTSSWQLKTTSNCAWLNAGPPPRVCNTRTRTVTP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000344235 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000290475 UPF0454 (22/128 aa) CDS Deleted
ENSMUSE00000290467 UPF0454 (51/128 aa) CDS CDS
ENSMUSE00000290455 UPF0454 (38/128 aa) CDS CDS
ENSMUSE00000459574 UPF0454 (18/128 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01537P1_C_54T_C4 N01537P1_T_160.6_B01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01537P1_C_54T_G1 N01537P1_T_160.6_B01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 116342 Deletion (Promotor Driven Cassette) N01537P1_T_160.6_B01 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
116342 Deletion N01537P1_I_160.6_B01