IKMC Project Report - NorCOMM (ID: 42637)

Rab1 MGI:97842 ENSMUSG00000020149 OTTMUSG00000005223
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000163483 protein_coding Novel C-terminal product view

Predicted translation: 

MTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000913793 UTR + start codon + CDS
ENSMUSE00001068456 Small_GTPase (19/161 aa) | MIRO-like (19/115 aa) | Small_GTPase_ARF/SAR (20/122 aa) | Gtr1_RagA (19/120 aa) | SRP_receptor_beta_su (18/119 aa) CDS Deleted
ENSMUSE00000992799 Small_GTPase (32/161 aa) | MIRO-like (32/115 aa) | Small_GTPase_ARF/SAR (32/122 aa) | Gtr1_RagA (32/120 aa) | ProtSyn_GTP-bd (19/124 aa) | SRP_receptor_beta_su (32/119 aa) CDS Deleted
ENSMUSE00000101195 Small_GTPase (32/161 aa) | MIRO-like (32/115 aa) | Small_GTPase_ARF/SAR (32/122 aa) | Gtr1_RagA (32/120 aa) | ProtSyn_GTP-bd (32/124 aa) | SRP_receptor_beta_su (32/119 aa) CDS
ENSMUSE00000580932 Small_GTPase (44/161 aa) | MIRO-like (32/115 aa) | Small_GTPase_ARF/SAR (38/122 aa) | Gtr1_RagA (37/120 aa) | ProtSyn_GTP-bd (44/124 aa) | SRP_receptor_beta_su (37/119 aa) CDS
ENSMUSE00000494348 Small_GTPase (34/161 aa) | ProtSyn_GTP-bd (29/124 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000020358 protein_coding Novel C-terminal product view

Predicted translation: 

MTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000463496 UTR + start codon + CDS
ENSMUSE00001068456 Small_GTPase (19/161 aa) | MIRO-like (19/115 aa) | Small_GTPase_ARF/SAR (20/122 aa) | Gtr1_RagA (19/120 aa) | SRP_receptor_beta_su (18/119 aa) CDS Deleted
ENSMUSE00000992799 Small_GTPase (32/161 aa) | MIRO-like (32/115 aa) | Small_GTPase_ARF/SAR (32/122 aa) | Gtr1_RagA (32/120 aa) | ProtSyn_GTP-bd (19/124 aa) | SRP_receptor_beta_su (32/119 aa) CDS Deleted
ENSMUSE00000101195 Small_GTPase (32/161 aa) | MIRO-like (32/115 aa) | Small_GTPase_ARF/SAR (32/122 aa) | Gtr1_RagA (32/120 aa) | ProtSyn_GTP-bd (32/124 aa) | SRP_receptor_beta_su (32/119 aa) CDS
ENSMUSE00000580932 Small_GTPase (44/161 aa) | MIRO-like (32/115 aa) | Small_GTPase_ARF/SAR (38/122 aa) | Gtr1_RagA (37/120 aa) | ProtSyn_GTP-bd (44/124 aa) | SRP_receptor_beta_su (37/119 aa) CDS
ENSMUSE00000494348 Small_GTPase (34/161 aa) | ProtSyn_GTP-bd (29/124 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000109602 protein_coding Novel C-terminal product view

Predicted translation: 

MTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000680886 UTR + start codon + CDS
ENSMUSE00001068456 Small_GTPase (19/21 aa) CDS Deleted
ENSMUSE00000580932 Small_GTPase (2/21 aa) | Small_GTPase (43/77 aa) CDS
ENSMUSE00000655343 Small_GTPase (34/77 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000109601 protein_coding Novel C-terminal product view

Predicted translation: 

MTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001036660 UTR + start codon + CDS
ENSMUSE00001068456 Small_GTPase (19/52 aa) | MIRO-like (19/56 aa) CDS Deleted
ENSMUSE00000992799 Small_GTPase (32/52 aa) | MIRO-like (32/56 aa) CDS Deleted
ENSMUSE00000680885 Small_GTPase (1/52 aa) | Small_GTPase (33/33 aa) | MIRO-like (5/56 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000132285 processed_transcript No analysis available: incomplete transcript
ENSMUST00000152728 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00087P0_C_33T_A5 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_B5 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_C5 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_C6 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_C7 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_D5 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_D7 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_E5 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_E6 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_E7 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_F5 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_F6 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_G7 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_H5 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_H6 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00087P0_C_33T_H7 N00087P0_T_124.5_G09 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 46765 Deletion (Promotorless Cassette) N00087P0_T_124.5_G09 L1L2_NTARU-2 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
46765 Deletion N00087P0_I_124.5_G09