IKMC Project Report - NorCOMM (ID: 42651)

Cops5 MGI:1349415 ENSMUSG00000025917 OTTMUSG00000029459
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027050 protein_coding No protein product (NMD) view

Predicted translation: 

MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKEMQTTPQARCLICLRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000827356 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000980397 JAB1_Mov34_MPN_PAD1 (72/110 aa) CDS Deleted
ENSMUSE00000967710 JAB1_Mov34_MPN_PAD1 (38/110 aa) CDS Deleted
ENSMUSE00000965257 CDS Deleted
ENSMUSE00000154170 CDS Deleted
ENSMUSE00000154173 CDS Deleted
ENSMUSE00000154167 CDS CDS + stop codon + UTR
ENSMUSE00000392276 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000139578 retained_intron No analysis available: incomplete transcript
ENSMUST00000150509 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01482P1_C_79W_F8 N01482P1_T_160.1_D09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01482P1_C_79W_G9 N01482P1_T_160.1_D09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 116383 Deletion (Promotor Driven Cassette) N01482P1_T_160.1_D09 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
116383 Deletion N01482P1_I_160.1_D09