IKMC Project Report - NorCOMM (ID: 42692)

Akap17b MGI:2443758 ENSMUSG00000059708 OTTMUSG00000017102
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation in Progress

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000051906 protein_coding No protein product (NMD) view

Predicted translation:

MTVTVVYDNSEATELCAAQHLYLKPIAKLMINVLLPECIEPVRPFSNWEVLDQLKSLICPDQFTTVRLSKSTKDFIRFEG
EAETRSLVQILKAKLHGKIIKLNGLKTDLKVVATDAQGEWEHFPKEKEASVIEGAEEQDHDKGPDSIYFEGLPCKWFAPK
GSSGEKPCEEILRVVFESFGKIKNVDIPMLDPYREVMTGGSFGGLNFGLQTFEAFIQYQESTDFIKAMESLRGMKLMLKG
DDGKALACNIKKKKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000449840 UTR UTR
ENSMUSE00000449825 UTR UTR
ENSMUSE00000398768 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001021969 CDS Deleted
ENSMUSE00000916318 CDS CDS + stop codon + UTR
ENSMUSE00000702179 CDS
ENSMUSE00000702178 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000133980 protein_coding Residual C-terminal product view

Predicted translation:

MRKEKNLKPCQTHISLLLNCLGSTQCNPQEVGVMKSEAHHTPGTALKSPEEEELNTRHLLDWEEMPSYQASTLDLSQKAE
KRCYQASKSDNKQKQKGKKKTKAQLQKSSHTPGVKQMRHSARKEETGKVLSDGCDYSLVSDQNSLQSTMIADQSLAKEDH
ASSNESHSSRQAVINRGRKQKIYETDEFIDYLLNYYQTPEYARFCLEASHLTSTCQWQRDVYAKGDGFQIYLRKQGYHSN
SLSEEESLQGIEQDEEQDWPQVYIKDPESKSQKTGKINYAKEF

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000744090 UTR UTR
ENSMUSE00000449825 UTR UTR
ENSMUSE00001036470 UTR + start codon + CDS Deleted
ENSMUSE00000916318 CDS
ENSMUSE00000702179 CDS UTR + start codon + CDS
ENSMUSE00000762669 CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available