IKMC Project Report - NorCOMM (ID: 42708)

Trove2 MGI:106652 ENSMUSG00000018199 OTTMUSG00000021864
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000159879 protein_coding No protein product (NMD) view

Predicted translation: 

MEGSANQLQPLSETQVVNSEGGCVWQVTDMNRLRRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSF
SQEGRTAKQEPLLFALAVCSQCADINTKQAAFKAVPEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAVADWYNEKG
GMAVALVVTKYKQRNGWSHKDLLRLSHLKPSSEGGYTDRKRVFGGCFCL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000158397 UTR UTR
ENSMUSE00001000716 TROVE (178/354 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001073304 TROVE (74/354 aa) CDS Deleted
ENSMUSE00000972674 TROVE (49/354 aa) CDS Deleted
ENSMUSE00000965491 TROVE (46/354 aa) CDS Deleted
ENSMUSE00000158400 TROVE (8/354 aa) CDS Deleted
ENSMUSE00000158398 CDS CDS + stop codon + UTR
ENSMUSE00000985080 CDS
ENSMUSE00000864770 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000018343 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N02064P1_C_236W_A1 N02064P1_T_189.4_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02064P1_C_236W_B1 N02064P1_T_189.4_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02064P1_C_236W_C1 N02064P1_T_189.4_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N02064P1_C_236W_F1 N02064P1_T_189.4_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 242207 Deletion (Promotor Driven Cassette) N02064P1_T_189.4_B07 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
242207 Deletion N02064P1_I_189.4_B07