IKMC Project Report - NorCOMM (ID: 42781)

F2 MGI:88380 ENSMUSG00000027249 OTTMUSG00000014282
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000028681 protein_coding No protein product (NMD) view

Predicted translation: 

MSHVRGLGLPGCLALAALVSLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERECVEEQCSYEEAFEALESPQD
TASR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000167347 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000167360 GLA_domain (32/41 aa) CDS CDS
ENSMUSE00000167350 GLA_domain (9/41 aa) CDS Deleted
ENSMUSE00000167357 GLA_domain (1/41 aa) CDS Deleted
ENSMUSE00000992074 Kringle (33/79 aa) CDS Deleted
ENSMUSE00000167343 Kringle (47/79 aa) CDS Deleted
ENSMUSE00000167353 Kringle (1/79 aa) | Kringle (79/79 aa) CDS Deleted
ENSMUSE00000167351 Kringle (1/79 aa) | Thrombin_light_chain (20/49 aa) CDS Deleted
ENSMUSE00000167345 Peptidase_S1_S6 (13/250 aa) | Thrombin_light_chain (30/49 aa) CDS Deleted
ENSMUSE00000167359 Peptidase_S1_S6 (57/250 aa) CDS Deleted
ENSMUSE00000167341 Peptidase_S1_S6 (59/250 aa) CDS Deleted
ENSMUSE00000167349 Peptidase_S1_S6 (62/250 aa) CDS Deleted
ENSMUSE00000167361 Peptidase_S1_S6 (24/250 aa) CDS CDS + stop codon + UTR
ENSMUSE00000389470 Peptidase_S1_S6 (39/250 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000111335 protein_coding No protein product (NMD) view

Predicted translation: 

MSHVRGLGLPGCLALAALVSLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERECVEEQCSYEEAFEALESPQD
TASR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000687470 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000167360 GLA_domain (32/41 aa) CDS CDS
ENSMUSE00000167350 GLA_domain (9/41 aa) CDS Deleted
ENSMUSE00000167357 GLA_domain (1/41 aa) CDS Deleted
ENSMUSE00000992074 Kringle (33/79 aa) CDS Deleted
ENSMUSE00000687469 Kringle (46/79 aa) CDS Deleted
ENSMUSE00000167353 Kringle (2/79 aa) | Kringle (79/79 aa) CDS Deleted
ENSMUSE00000167351 Kringle (1/79 aa) | Thrombin_light_chain (20/49 aa) CDS Deleted
ENSMUSE00000167345 Peptidase_S1_S6 (13/250 aa) | Thrombin_light_chain (30/49 aa) CDS Deleted
ENSMUSE00000167359 Peptidase_S1_S6 (57/250 aa) CDS Deleted
ENSMUSE00000167341 Peptidase_S1_S6 (59/250 aa) CDS Deleted
ENSMUSE00000167349 Peptidase_S1_S6 (62/250 aa) CDS Deleted
ENSMUSE00000167361 Peptidase_S1_S6 (24/250 aa) CDS CDS + stop codon + UTR
ENSMUSE00000687467 Peptidase_S1_S6 (39/250 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153182 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01571P1_C_64W_B5 N01571P1_T_160.6_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01571P1_C_64W_C3 N01571P1_T_160.6_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01571P1_C_64W_C4 N01571P1_T_160.6_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01571P1_C_64W_E3 N01571P1_T_160.6_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01571P1_C_64W_E4 N01571P1_T_160.6_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01571P1_C_64W_F2 N01571P1_T_160.6_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01571P1_C_64W_F3 N01571P1_T_160.6_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01571P1_C_64W_H3 N01571P1_T_160.6_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 116439 Deletion (Promotor Driven Cassette) N01571P1_T_160.6_A07 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
116439 Deletion N01571P1_I_160.6_A07