IKMC Project Report - KOMP-CSD (ID: 43941)

Wac MGI:2387357 ENSMUSG00000024283 OTTMUSG00000036803
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 17 wild type transcripts, of which 15 are protein-coding. Following removal of the floxed region, 15 transcripts are predicted to produce a truncated protein product of which 6 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000167020 protein_coding No protein product (NMD) view

Predicted translation: 

MVMYARKQQRLSDGCHDRRGDSQPFQALKYSSKSHPSSGDHRHEKMRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKN
VHTQRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTSDARTETKRSK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000872697 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001043294 CDS CDS
ENSMUSE00000985259 CDS CDS
ENSMUSE00000520309 CDS CDS
ENSMUSE00000494078 WW_Rsp5_WWP (27/27 aa) CDS Deleted
ENSMUSE00000493156 CDS CDS + stop codon + UTR
ENSMUSE00000502930 CDS
ENSMUSE00000504937 CDS
ENSMUSE00000500224 CDS
ENSMUSE00000499374 CDS
ENSMUSE00000483869 CDS
ENSMUSE00000297151 CDS
ENSMUSE00000485782 CDS
ENSMUSE00000891367 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000092112 protein_coding No protein product (NMD) view

Predicted translation: 

MVMYARKQQRLSDGCHDRRGDSQPFQALKYSSKSHPSSGDHRHEKMRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKN
VHTQRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTSDARTETKRSK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000909475 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001043294 CDS CDS
ENSMUSE00000985259 CDS CDS
ENSMUSE00000520309 CDS CDS
ENSMUSE00000494078 WW_Rsp5_WWP (27/27 aa) CDS Deleted
ENSMUSE00000493156 CDS CDS + stop codon + UTR
ENSMUSE00000504937 CDS
ENSMUSE00000500224 CDS
ENSMUSE00000499374 CDS
ENSMUSE00000483869 CDS
ENSMUSE00000297151 CDS
ENSMUSE00000485782 CDS
ENSMUSE00000915476 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000074919 protein_coding No protein product (NMD) view

Predicted translation: 

MRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTS
DARTETKRSK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000906239 UTR UTR
ENSMUSE00000992111 UTR UTR
ENSMUSE00001023631 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000520309 CDS CDS
ENSMUSE00000494078 WW_Rsp5_WWP (27/27 aa) CDS Deleted
ENSMUSE00000493156 CDS CDS + stop codon + UTR
ENSMUSE00000502930 CDS
ENSMUSE00000504937 CDS
ENSMUSE00000500224 CDS
ENSMUSE00000499374 CDS
ENSMUSE00000483869 CDS
ENSMUSE00000297151 CDS
ENSMUSE00000485782 CDS
ENSMUSE00000368415 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000172018 protein_coding No protein product (NMD) view

Predicted translation: 

MRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTS
DARTETKRSK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000899809 UTR UTR
ENSMUSE00000992111 UTR UTR
ENSMUSE00001023631 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000520309 CDS CDS
ENSMUSE00000494078 WW_Rsp5_WWP (27/27 aa) CDS Deleted
ENSMUSE00000493156 CDS CDS + stop codon + UTR
ENSMUSE00000502930 CDS
ENSMUSE00000504937 CDS
ENSMUSE00000873706 CDS
ENSMUSE00000499374 CDS
ENSMUSE00000483869 CDS
ENSMUSE00000892887 CDS
ENSMUSE00000485782 CDS
ENSMUSE00000912045 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000171486 protein_coding No protein product (NMD) view

Predicted translation: 

MRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTS
DARTETKRSK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000909582 UTR UTR
ENSMUSE00000992111 UTR UTR
ENSMUSE00001023631 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000520309 CDS CDS
ENSMUSE00000494078 WW_Rsp5_WWP (27/27 aa) CDS Deleted
ENSMUSE00000493156 CDS CDS + stop codon + UTR
ENSMUSE00000504937 CDS
ENSMUSE00000873706 CDS
ENSMUSE00000499374 CDS
ENSMUSE00000483869 CDS
ENSMUSE00000297151 CDS
ENSMUSE00000485782 CDS
ENSMUSE00000912045 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000171042 protein_coding No protein product (NMD) view

Predicted translation: 

MRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTS
DARTETKRSK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000906489 UTR UTR
ENSMUSE00000992111 UTR UTR
ENSMUSE00001023631 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000520309 CDS CDS
ENSMUSE00000494078 WW_Rsp5_WWP (27/27 aa) CDS Deleted
ENSMUSE00000493156 CDS CDS + stop codon + UTR
ENSMUSE00000504937 CDS
ENSMUSE00000891727 CDS
ENSMUSE00000499374 CDS
ENSMUSE00000483869 CDS
ENSMUSE00000297151 CDS
ENSMUSE00000485782 CDS
ENSMUSE00000894639 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166062 protein_coding No analysis available: incomplete transcript
ENSMUST00000168446 protein_coding No analysis available: incomplete transcript
ENSMUST00000169010 protein_coding No analysis available: incomplete transcript
ENSMUST00000166378 protein_coding Target region does not overlap transcript
ENSMUST00000170932 protein_coding Target region does not overlap transcript
ENSMUST00000165854 protein_coding No analysis available: incomplete transcript
ENSMUST00000170854 protein_coding No analysis available: incomplete transcript
ENSMUST00000169478 protein_coding Target region does not overlap transcript
ENSMUST00000167542 protein_coding Target region does not overlap transcript
ENSMUST00000165572 retained_intron Target region does not overlap transcript
ENSMUST00000167057 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0290_2_C09 PRPGS00131_B_G04 Wactm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0290_2_E09 PRPGS00131_B_G04 Wactm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number fail Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR fail
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0290_2_D09 PRPGS00131_B_G04 Wactm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a pass Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0290_2_D09 PRPGS00131_B_G04 Wactm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.9 - 0.81 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a pass Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0290_2_A12 PRPGS00131_B_G04 Wactm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0290_2_E10 PRPGS00131_B_G04 Wactm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0290_2_E11 PRPGS00131_B_G04 Wactm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0290_2_G11 PRPGS00131_B_G04 Wactm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0290_2_D10 PRPGS00131_B_G04 Wactm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0290_2_A09 PRPGS00131_B_G04 Wactm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 185935 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00131_Y_4_G04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 185935 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00131_Y_2_G04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 185935 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00131_Y_1_G04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 185935 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00131_Y_2_G02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 185935 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00131_B_G04 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
185935 Knockout-First - Reporter Tagged Insertion PCS00131_A_G04