IKMC Project Report - KOMP-CSD (ID: 44571)

Glp1r MGI:99571 ENSMUSG00000024027
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000114574 protein_coding No protein product (NMD) view

Predicted translation:

MASTPSLLRLALLLLGAVGRAGPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSF
VNVSCPWYLPWASSDTCTAPGTTST*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000413961 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000318687 CDS CDS
ENSMUSE00000137339 GPCR_2_extracellular_dom (35/68 aa) CDS CDS
ENSMUSE00000137335 GPCR_2_extracellular_dom (34/68 aa) CDS Deleted
ENSMUSE00000137343 GPCR_2_secretin-like (27/256 aa) CDS Deleted
ENSMUSE00000137341 GPCR_2_secretin-like (52/256 aa) CDS CDS + stop codon + UTR
ENSMUSE00000137337 GPCR_2_secretin-like (54/256 aa) CDS
ENSMUSE00000137332 GPCR_2_secretin-like (21/256 aa) CDS
ENSMUSE00000137333 GPCR_2_secretin-like (24/256 aa) CDS
ENSMUSE00000137340 GPCR_2_secretin-like (30/256 aa) CDS
ENSMUSE00000548438 GPCR_2_secretin-like (47/256 aa) CDS
ENSMUSE00000137336 GPCR_2_secretin-like (5/256 aa) CDS
ENSMUSE00000699816 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available