IKMC Project Report - KOMP-CSD (ID: 45030)

Podnl1 MGI:2685352 ENSMUSG00000012889 OTTMUSG00000030575
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000093380 protein_coding No protein product (NMD) view

Predicted translation:

MRPQELLLLLLMLKWSLAHTEDPAFPHLGDSSQPLPRPCPWRCSCPRDDTVDCAGLDLRIFPDNITRAARHLSLQNNQLR
ELPYNELSRLSGLRTLDLHSNLITSEGLPDEAFESLNQLENFYVAHNKLSVAPQFLPRSLRVADLAANEVVEIFPLTFGE
KPALRTILSPRCPEEH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000606699 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000606698 Leu-rich_rpt (5/21 aa) CDS CDS
ENSMUSE00000581449 Leu-rich_rpt (16/21 aa) | Leu-rich_rpt (14/24 aa) CDS CDS
ENSMUSE00000435452 Leu-rich_rpt (11/24 aa) CDS CDS
ENSMUSE00000681613 CDS CDS
ENSMUSE00000581448 Leu-rich_rpt (17/17 aa) CDS Deleted
ENSMUSE00001076342 Leu-rich_rpt (22/25 aa) CDS CDS + stop codon + UTR
ENSMUSE00000581447 Leu-rich_rpt (4/25 aa) | Leu-rich_rpt (19/19 aa) | Leu-rich_rpt (17/17 aa) | Leu-rich_rpt (1/18 aa) CDS
ENSMUSE00000581454 Leu-rich_rpt (17/18 aa) CDS
ENSMUSE00000508723 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000147175 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available