IKMC Project Report - EUCOMM (ID: 45079)

Mag MGI:96912 ENSMUSG00000036634
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000040548 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MIFLATLPLFWIMISASRGGHWGAWMPSTISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSRTQV
VHESFQGRSRLLGDLGLRNCTLLLSTLSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVIAPIILLESHCAAARDTVQCLC
VVKSNPEPSVAFELPSRNVTVNETEREFVYSERSGLLLTSILTIRGQAQAPPRVICTSRNLYGTQSLELPFQGAHRLMWA
KIGPVGAVVAFAILIAIVCYITQTRRKKNVTESSSFSGGDNPHVLYSPEFRISGAPDKYESREVSTRDCH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000356711 UTR UTR
ENSMUSE00000240774 UTR UTR
ENSMUSE00000517825 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000240757 CDS CDS
ENSMUSE00000240746 CD80_C2-set (82/82 aa) CDS Deleted
ENSMUSE00000240739 Ig_I-set (83/83 aa) CDS Deleted
ENSMUSE00000240732 Ig_I-set (76/76 aa) | Immunoglobulin (55/55 aa) CDS Deleted
ENSMUSE00000240721 CDS CDS
ENSMUSE00000240715 CDS CDS
ENSMUSE00000240710 CDS CDS
ENSMUSE00000373997 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001048055 UTR UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0645_1_H03 PG00143_Z_1_A02 Magtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0645_1_E01 PG00143_Z_1_A02 Magtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0645_1_B03 PG00143_Z_1_A02 Magtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0645_1_C03 PG00143_Z_1_A02 Magtm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_C01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_2_D03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_6_F09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_A04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_H02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_6_B01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_6_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_D06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_B11 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_D10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_G12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_2_B08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_D05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_2_F01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_6_E12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_E07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_C07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_6_F11 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_6_B10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_C03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_2_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_B03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 211000 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00143_Z_1_F11 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
211000 Knockout First, Reporter-tagged insertion with conditional potential PCTS00143_A_A11