IKMC Project Report - EUCOMM (ID: 45186)

Zc3h12d MGI:3045313 ENSMUSG00000039981
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000039484 protein_coding No protein product (NMD) view

Predicted translation:

MEHRSKMEFFQKLGYSQEDVVRVLGKLGDSALVNDVLQELIQTGSRPRAQEDPASGTGVVLIPRGCCGVQDSAQQGLGPG
LEEAGGDPARFLRPIVIDGSNVAMRATRAGGTGAASCVGVYPIPQGERQASGLLR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000359635 UTR UTR
ENSMUSE00000392000 RNase_Zc3h12 (13/155 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000577364 RNase_Zc3h12 (48/155 aa) CDS Deleted
ENSMUSE00000322377 RNase_Zc3h12 (79/155 aa) CDS CDS + stop codon + UTR
ENSMUSE00000405311 RNase_Zc3h12 (18/155 aa) CDS
ENSMUSE00000358172 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available