IKMC Project Report - KOMP-CSD (ID: 45242)

Rab5a MGI:105926 ENSMUSG00000017831
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000017975 protein_coding No protein product (NMD) view

Predicted translation: 

MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGGSTVLCR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000321375 UTR UTR
ENSMUSE00000364151 Small_GTPase (33/160 aa) | MIRO-like (33/115 aa) | Small_GTPase_ARF/SAR (35/154 aa) | Gtr1_RagA (33/134 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000542060 Small_GTPase (51/160 aa) | MIRO-like (51/115 aa) | Small_GTPase_ARF/SAR (51/154 aa) | Gtr1_RagA (51/134 aa) | ProtSyn_GTP-bd (46/124 aa) CDS Deleted
ENSMUSE00000136476 Small_GTPase (41/160 aa) | MIRO-like (32/115 aa) | Small_GTPase_ARF/SAR (41/154 aa) | Gtr1_RagA (41/134 aa) | ProtSyn_GTP-bd (41/124 aa) CDS Deleted
ENSMUSE00000542056 Small_GTPase (32/160 aa) | Small_GTPase_ARF/SAR (28/154 aa) | Gtr1_RagA (10/134 aa) | ProtSyn_GTP-bd (32/124 aa) CDS CDS + stop codon + UTR
ENSMUSE00000542054 Small_GTPase (5/160 aa) | ProtSyn_GTP-bd (6/124 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available