IKMC Project Report - KOMP-CSD (ID: 46492)

Nabp2 MGI:1917167 ENSMUSG00000025374 OTTMUSG00000035847
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
currently unavailable Genotype confirmed Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) EPD0256_1_D05 C57BL/6NCrl;C57BL/6NCrl;C57BL/6N-Atm1Brd/a view
( about ) 		UCD/
Southern Blot na TV Backbone Assay na 5' LR-PCR na
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) na
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation na 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000026439 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MTTETFVKDIKPGLKNLNLIFIVLETASENQNGNGLSTQLGPVGGPHPSHTPSHPPSTRITRSQPNHTPSGPPGPSSNPV
SNGKETRRSSKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000400333 UTR UTR
ENSMUSE00001066706 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00000406691 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166608 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MRVQEDLPTGCHGSGSMTTETFVKDIKPGLKNLNLIFIVLETASENQNGNGLSTQLGPVGGPHPSHTPSHPPSTRITRSQ
PNHTPSGPPGPSSNPVSNGKETRRSSKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000886705 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000968732 CDS CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00000883024 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000164199 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MTTETFVKDIKPGLKNLNLIFIVLETASENQNGNGLSTQLGPVGGPHPSHTPSHPPSTRITRSQPNHTPSGPPGPSSNPV
SNGKETRRSSKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000887882 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00000406691 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000172348 protein_coding No protein product view

Predicted translation: 

MTTETFVKDIKPGLKNLNLIFIVLETASENQNGN

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000892901 UTR UTR
ENSMUSE00001066706 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00000872719 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000164664 protein_coding No protein product view

Predicted translation: 

MTTETFVKDIKPGLKNLNLIFIVLETASENQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000894384 UTR UTR
ENSMUSE00001066706 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983155 NA-bd_OB_tRNA-helicase (46/58 aa) CDS Deleted
ENSMUSE00001023095 NA-bd_OB_tRNA-helicase (13/58 aa) CDS Deleted
ENSMUSE00001051908 CDS Deleted
ENSMUSE00001062722 CDS Deleted
ENSMUSE00001077890 CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
ENSMUST00000171494 protein_coding No analysis available: incomplete transcript
ENSMUST00000171370 protein_coding No analysis available: incomplete transcript
ENSMUST00000172238 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000167456 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0256_1_B06 PRPGS00126_A_D07 Nabp2tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype 0.8 - 0.71 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0256_1_D05 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view yes view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_A05 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.8 - 0.71 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_B05 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_B07 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_C07 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_C08 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_D06 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_D08 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_E06 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_F05 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0256_1_G08 PRPGS00126_A_D07 Nabp2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Z_3_D07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Z_4_D07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Z_1_C07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Z_1_D07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Z_2_C07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Z_2_D07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Z_3_C07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00126_Z_4_C07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 119225 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00126_A_D07 L1L2_Pgk_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
119225 Knockout First, Reporter-tagged insertion with conditional potential PCS00126_B_D07