IKMC Project Report - KOMP-CSD (ID: 46620)

Map3k8 MGI:1346878 ENSMUSG00000024235 OTTMUSG00000037645
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000025078 protein_coding No protein product (NMD) view

Predicted translation:

MEYMSTGSDEKEEIDLLIKHLNVSEVIDIMENLYASEEPGVYEPSLMTMYPDSNQNEERSESLLRSGQEVPWLSSVRYGT
VEDLLAFANHVSNMTKHFYGRRPQECGILLNMVISPQNGRYQIDSDVLLVPWKLTYRNIGSGFVPRGAFGKVYLAQDMKT
KKRMACKLLATLYSCLQKLFW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000140081 UTR UTR
ENSMUSE00000140085 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000140084 Prot_kinase_cat_dom (22/241 aa) | Ser-Thr/Tyr_kinase_cat_dom (22/239 aa) CDS CDS
ENSMUSE00000140080 Prot_kinase_cat_dom (88/241 aa) | Ser-Thr/Tyr_kinase_cat_dom (88/239 aa) CDS Deleted
ENSMUSE00000974642 Prot_kinase_cat_dom (36/241 aa) | Ser-Thr/Tyr_kinase_cat_dom (36/239 aa) CDS CDS + stop codon + UTR
ENSMUSE00000993716 Prot_kinase_cat_dom (51/241 aa) | Ser-Thr/Tyr_kinase_cat_dom (51/239 aa) CDS
ENSMUSE00001058295 Prot_kinase_cat_dom (45/241 aa) | Ser-Thr/Tyr_kinase_cat_dom (43/239 aa) CDS
ENSMUSE00000140082 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000173930 nonsense_mediated_decay Design floxes no exons in transcript ENSMUST00000173930
ENSMUST00000172805 retained_intron Target region does not overlap transcript
ENSMUST00000105472 processed_transcript Target region does not overlap transcript
ENSMUST00000173708 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available