IKMC Project Report - EUCOMM (ID: 46805)

C2cd5 MGI:1921991 ENSMUSG00000030279
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000111758 protein_coding No protein product (NMD) view

Predicted translation: 

MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEVDDEDLQDEPLQITVLDHDTY
SANDAIGKVYIDIDPLLYSEAATVISGWFPIYDTIHGIRGEINVVVKVDLFNDSNRFRQSSCGVKFFCTTSIPKCYRAVV
IHGFVEELVVNEDPEYQWIDRIRTPRASNEARQRLISLMSGELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIG
TACTLDKLSSPAAFLPACSSPSRELKEIPFNEDPNPNTHSSGPSTPLKNQTYSFSPSKSYSRQSSSSDTDLSLTPKTGVP
VPHPDGLPPWTSCARRWRCQCTLCEAFRSDPQP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000688919 UTR UTR
ENSMUSE00000431703 C2_Ca-dep (25/85 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000431249 C2_Ca-dep (29/85 aa) CDS CDS
ENSMUSE00000431240 C2_Ca-dep (31/85 aa) CDS CDS
ENSMUSE00000386344 CDS CDS
ENSMUSE00000361445 CDS CDS
ENSMUSE00000374448 CDS CDS
ENSMUSE00000387889 CDS CDS
ENSMUSE00000361046 CDS Deleted
ENSMUSE00000384986 CDS CDS
ENSMUSE00000358464 CDS CDS + stop codon + UTR
ENSMUSE00000414719 CDS
ENSMUSE00000367016 CDS
ENSMUSE00000294678 CDS
ENSMUSE00000294669 CDS
ENSMUSE00000294659 CDS
ENSMUSE00000412375 CDS
ENSMUSE00000353954 CDS
ENSMUSE00000294776 CDS
ENSMUSE00000294769 CDS
ENSMUSE00000197014 CDS
ENSMUSE00000197012 CDS
ENSMUSE00000431145 CDS
ENSMUSE00000197011 CDS
ENSMUSE00000197013 CDS
ENSMUSE00000608361 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000171349 protein_coding No protein product (NMD) view

Predicted translation: 

MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEVDDEDLQDEPLQITVLDHDTY
SANDAIGKVYIDIDPLLYSEAATVISGWFPIYDTIHGIRGEINVVVKVDLFNDSNRFRQSSCGVKFFCTTSIPKCYRAVV
IHGFVEELVVNEDPEYQWIDRIRTPRASNEARQRLISLMSGELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIG
TACTLDKLSSPAAFLPACSSPSRELKEIPFNEDPNPNTHSSGPSTPLKNQTYSFSPSKSYSRQSSSSDTDLSLTPKTGVP
VPHPDGLPPWTSCARRWRCQCTLCEAFRSDPQP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000688919 UTR UTR
ENSMUSE00000431703 C2_Ca-dep (25/85 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000431249 C2_Ca-dep (29/85 aa) CDS CDS
ENSMUSE00000431240 C2_Ca-dep (31/85 aa) CDS CDS
ENSMUSE00000386344 CDS CDS
ENSMUSE00000361445 CDS CDS
ENSMUSE00000374448 CDS CDS
ENSMUSE00000387889 CDS CDS
ENSMUSE00000361046 CDS Deleted
ENSMUSE00000384986 CDS CDS
ENSMUSE00000358464 CDS CDS + stop codon + UTR
ENSMUSE00000414719 CDS
ENSMUSE00000367016 CDS
ENSMUSE00000294678 CDS
ENSMUSE00000294669 CDS
ENSMUSE00000294659 CDS
ENSMUSE00000412375 CDS
ENSMUSE00000353954 CDS
ENSMUSE00000294776 CDS
ENSMUSE00000294769 CDS
ENSMUSE00000197014 CDS
ENSMUSE00000197012 CDS
ENSMUSE00000197011 CDS
ENSMUSE00000197013 CDS
ENSMUSE00000608361 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000087485 protein_coding No protein product (NMD) view

Predicted translation: 

MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEVDDEDLQDEPLQITVLDHDTY
SANDAIGKVYIDIDPLLYSEAATVISGWFPIYDTIHGIRGEINVVVKVDLFNDSNRFRQSSCGVKFFCTTSIPKCYRAVV
IHGFVEELVVNEDPEYQWIDRIRTPRASNEARQRLISLMSGELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIG
TACTLDKLSSPAAFLPACSSPSRELKESPLVHPPSHGCRSTHNSPIHTATGSRLTQNFSVSVPTLIYTGVPVPHPDGLPP
WTSCARRWRCQCTLCEAFRSDPQP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000688919 UTR UTR
ENSMUSE00000431703 C2_Ca-dep (25/85 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000431249 C2_Ca-dep (29/85 aa) CDS CDS
ENSMUSE00000431240 C2_Ca-dep (31/85 aa) CDS CDS
ENSMUSE00000386344 CDS CDS
ENSMUSE00000361445 CDS CDS
ENSMUSE00000374448 CDS CDS
ENSMUSE00000545970 CDS CDS
ENSMUSE00000361046 CDS Deleted
ENSMUSE00000384986 CDS CDS
ENSMUSE00000358464 CDS CDS + stop codon + UTR
ENSMUSE00000414719 CDS
ENSMUSE00000367016 CDS
ENSMUSE00000294678 CDS
ENSMUSE00000294669 CDS
ENSMUSE00000294659 CDS
ENSMUSE00000412375 CDS
ENSMUSE00000353954 CDS
ENSMUSE00000294776 CDS
ENSMUSE00000294769 CDS
ENSMUSE00000197014 CDS
ENSMUSE00000197012 CDS
ENSMUSE00000197011 CDS
ENSMUSE00000197013 CDS
ENSMUSE00000608361 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0542_8_F01 PRPGS00140_A_G02 C2cd5tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_A02 PRPGS00140_A_G02 C2cd5tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_A03 PRPGS00140_A_G02 C2cd5tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_D02 PRPGS00140_A_G02 C2cd5tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_F03 PRPGS00140_A_G02 C2cd5tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_F04 PRPGS00140_A_G02 C2cd5tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_E04 PRPGS00140_A_G02 C2cd5tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0542_8_C03 PRPGS00140_A_G02 C2cd5tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_C02 PRPGS00140_A_G02 C2cd5tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_G04 PRPGS00140_A_G02 C2cd5tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_G03 PRPGS00140_A_G02 C2cd5tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_D01 PRPGS00140_A_G02 C2cd5tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_E03 PRPGS00140_A_G02 C2cd5tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_B02 PRPGS00140_A_G02 C2cd5tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0542_8_G01 PRPGS00140_A_G02 C2cd5tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00140_A_G02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00140_Y_4_G02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00140_Y_2_G08 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00140_Y_3_G02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00140_Y_2_G02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00140_Y_3_G08 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00140_Y_1_G08 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00140_Y_1_G02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 179771 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00140_Y_4_G08 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
179771 Knockout First, Reporter-tagged insertion with conditional potential PCS00140_A_G02