IKMC Project Report - KOMP-CSD (ID: 47165)

Apba1 MGI:1860297 ENSMUSG00000024897
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000025830 protein_coding No protein product (NMD) view

Predicted translation:

MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVVEGQQPSPSPPPPAGHEPEDHRGHPAPPPPPPPQEEEEEERGECLA
RSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYAVQYRPEAEEYTEQAEAEHVEAAQRRALPNHLHFHSLE
HEEAMNAAYSGYVYTHRLFHRAEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLH
HYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERAPTPGGGHPDSPGL
PAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQR
PVDGDSPSPGSSSPLGAESSSIPLHPGDPTEASTNKESRKSLASFPTYVEDGPEISQKQEEGS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000642342 UTR UTR
ENSMUSE00000620593 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000452692 CDS CDS
ENSMUSE00000452687 CDS CDS
ENSMUSE00000249527 PTyr_interaction_dom (33/158 aa) CDS Deleted
ENSMUSE00000249518 PTyr_interaction_dom (11/158 aa) CDS CDS
ENSMUSE00000145942 PTyr_interaction_dom (29/158 aa) CDS CDS + stop codon + UTR
ENSMUSE00000145937 PTyr_interaction_dom (62/158 aa) CDS
ENSMUSE00000145939 PTyr_interaction_dom (23/158 aa) CDS
ENSMUSE00000145953 PDZ (69/82 aa) CDS
ENSMUSE00000145950 PDZ (13/82 aa) | PDZ (14/67 aa) CDS
ENSMUSE00000145946 PDZ (47/67 aa) CDS
ENSMUSE00000510835 PDZ (6/67 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available