IKMC Project Report - KOMP-CSD (ID: 47740)

Capns1 MGI:88266 ENSMUSG00000001794 OTTMUSG00000022203
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000001845 protein_coding No protein product (NMD) view

Predicted translation:

MFLVNSFLKGGGGGGGGGGLGGGLGNVLGGLISGAAGGGGGGGGGMGLGGGGGGGGTAMRILGGVISAISEAAAQYNPEP
PDST*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000754132 UTR UTR
ENSMUSE00000496920 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001018558 CDS CDS
ENSMUSE00001011268 CDS Deleted
ENSMUSE00001028478 CDS Deleted
ENSMUSE00000979800 CDS Deleted
ENSMUSE00000977710 CDS Deleted
ENSMUSE00001052229 CDS Deleted
ENSMUSE00001005473 CDS CDS + stop codon + UTR
ENSMUSE00000980577 CDS
ENSMUSE00000470784 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000126116 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MFLVNSFLKGGGGGGGGGGLGGGLGNVLGGLISGAAGGGGGGGGGMGLGGGGGGGGTAMRILGGVISAISEAAAQYNPEP
PDST*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000727181 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001018558 CDS CDS
ENSMUSE00001011268 CDS Deleted
ENSMUSE00001028478 CDS Deleted
ENSMUSE00000979800 CDS Deleted
ENSMUSE00000977710 CDS Deleted
ENSMUSE00001052229 CDS Deleted
ENSMUSE00000820958 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000108196 protein_coding Residual C-terminal product view

Predicted translation:

MIIRRYADESGNMDFDNFISCLVRLDAMFRAFKSLDKNGTGQIQVNIQEWLQLTMYS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000675904 UTR + start codon + CDS
ENSMUSE00001018558 CDS
ENSMUSE00001011268 CDS Deleted
ENSMUSE00001028478 CDS Deleted
ENSMUSE00000979800 CDS Deleted
ENSMUSE00000977710 CDS Deleted
ENSMUSE00001052229 CDS Deleted
ENSMUSE00001005473 CDS UTR + start codon + CDS
ENSMUSE00000980577 CDS CDS
ENSMUSE00000675903 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000129761 processed_transcript No analysis available: incomplete transcript
ENSMUST00000148973 processed_transcript Target region does not overlap transcript
ENSMUST00000146852 retained_intron Target region does not overlap transcript
ENSMUST00000141851 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available