IKMC Project Report - EUCOMM (ID: 48025)

Trappc11 MGI:2444585 ENSMUSG00000038102 OTTMUSG00000028479
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000039061 protein_coding No protein product (NMD) view

Predicted translation:

MSPTQWDFPVELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANRRADRVPISFKVLPGDHEYPKCRSKRTSYEWYIPKGV
LKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATRVEIVRGRCHCFGAGCGLMQCV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000766948 UTR UTR
ENSMUSE00000969364 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001089481 CDS CDS
ENSMUSE00001056137 CDS Deleted
ENSMUSE00000996238 CDS CDS + stop codon + UTR
ENSMUSE00001065045 CDS
ENSMUSE00000967071 CDS
ENSMUSE00001090367 Foie-gras_1 (13/258 aa) CDS
ENSMUSE00001026246 Foie-gras_1 (45/258 aa) CDS
ENSMUSE00001066558 Foie-gras_1 (50/258 aa) CDS
ENSMUSE00001015934 Foie-gras_1 (32/258 aa) CDS
ENSMUSE00000997766 Foie-gras_1 (27/258 aa) CDS
ENSMUSE00000975723 Foie-gras_1 (27/258 aa) CDS
ENSMUSE00000607900 Foie-gras_1 (19/258 aa) CDS
ENSMUSE00000607899 Foie-gras_1 (49/258 aa) CDS
ENSMUSE00001012086 CDS
ENSMUSE00001093105 CDS
ENSMUSE00001052092 CDS
ENSMUSE00001029529 CDS
ENSMUSE00000989954 CDS
ENSMUSE00001003522 CDS
ENSMUSE00001091827 CDS
ENSMUSE00000976295 CDS
ENSMUSE00001045694 CDS
ENSMUSE00000972703 CDS
ENSMUSE00001010360 DUF1683_C (6/118 aa) CDS
ENSMUSE00001075019 DUF1683_C (32/118 aa) CDS
ENSMUSE00001024372 DUF1683_C (45/118 aa) CDS
ENSMUSE00001012040 DUF1683_C (37/118 aa) CDS
ENSMUSE00000825637 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000120987 protein_coding Target region does not overlap transcript
ENSMUST00000125065 retained_intron No analysis available: incomplete transcript
ENSMUST00000123958 retained_intron Target region does not overlap transcript
ENSMUST00000131551 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available