IKMC Project Report - KOMP-CSD (ID: 48196)

Rab11a MGI:1858202 ENSMUSG00000004771 OTTMUSG00000036848
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000172298 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MGTRDDEYDYLFKEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKV
QCCQNI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000903431 Small_GTPase (1/161 aa) | MIRO-like (1/115 aa) | Small_GTPase_ARF/SAR (2/133 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001035657 Small_GTPase (66/161 aa) | MIRO-like (66/115 aa) | Small_GTPase_ARF/SAR (66/133 aa) | ProtSyn_GTP-bd (44/137 aa) CDS Deleted
ENSMUSE00000964171 Small_GTPase (66/161 aa) | MIRO-like (50/115 aa) | Small_GTPase_ARF/SAR (66/133 aa) | ProtSyn_GTP-bd (66/137 aa) CDS Deleted
ENSMUSE00001003404 Small_GTPase (28/161 aa) | Small_GTPase_ARF/SAR (2/133 aa) | ProtSyn_GTP-bd (28/137 aa) CDS CDS
ENSMUSE00000890857 Small_GTPase (4/161 aa) | ProtSyn_GTP-bd (2/137 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000004892 protein_coding No protein product view

Predicted translation: 

MGTRDDEYDYLFKEIYRIVSQKQMS

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000893532 Small_GTPase (1/134 aa) | MIRO-like (1/115 aa) | Small_GTPase_ARF/SAR (2/142 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001035657 Small_GTPase (66/134 aa) | MIRO-like (66/115 aa) | Small_GTPase_ARF/SAR (66/142 aa) | ProtSyn_GTP-bd (44/104 aa) CDS Deleted
ENSMUSE00000964171 Small_GTPase (66/134 aa) | MIRO-like (50/115 aa) | Small_GTPase_ARF/SAR (66/142 aa) | ProtSyn_GTP-bd (61/104 aa) CDS Deleted
ENSMUSE00000872936 Small_GTPase (4/134 aa) | Small_GTPase_ARF/SAR (11/142 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000169058 protein_coding No protein product view

Predicted translation: 

MGTRDDEYDYLFKEKNEANVRQT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000902053 Small_GTPase (1/136 aa) | MIRO-like (1/115 aa) | Small_GTPase_ARF/SAR (2/128 aa) CDS CDS
ENSMUSE00001035657 Small_GTPase (66/136 aa) | MIRO-like (66/115 aa) | Small_GTPase_ARF/SAR (66/128 aa) | ProtSyn_GTP-bd (44/111 aa) CDS Deleted
ENSMUSE00000964171 Small_GTPase (66/136 aa) | MIRO-like (50/115 aa) | Small_GTPase_ARF/SAR (62/128 aa) | ProtSyn_GTP-bd (66/111 aa) CDS Deleted
ENSMUSE00000988024 Small_GTPase (4/136 aa) | ProtSyn_GTP-bd (3/111 aa) CDS CDS
ENSMUSE00000903933 Small_GTPase (3/136 aa) CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
ENSMUST00000167569 protein_coding Design floxes no exons in transcript ENSMUST00000167569
ENSMUST00000171100 protein_coding Novel N-terminal, residual C-terminal product view

Predicted translation: 

MGTRDDEYDYLFKEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIH

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000900024 UTR UTR + start codon + CDS
ENSMUSE00001082595 Small_GTPase (24/54 aa) UTR + start codon + CDS Deleted
ENSMUSE00001003404 Small_GTPase (28/54 aa) CDS CDS
ENSMUSE00000884062 Small_GTPase (4/54 aa) CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
ENSMUST00000168366 protein_coding No analysis available: incomplete transcript
ENSMUST00000165083 processed_transcript No analysis available: incomplete transcript
ENSMUST00000172444 retained_intron Target region does not overlap transcript
ENSMUST00000166857 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0267_4_C09 PRPGS00129_A_B08 Rab11atm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) fail Vector Integrity -
Distribution Centre
Karyotype 0.8 - 0.71 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 198411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00129_A_B08 L1L2_Pgk_P L3L4_pD223_DTA_T_spec view
order 198411 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00129_Z_4_B08 L1L2_Pgk_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
198411 Knockout First, Reporter-tagged insertion with conditional potential PCS00129_A_B08