IKMC Project Report - EUCOMM (ID: 48424)

L2hgdh MGI:2384968 ENSMUSG00000020988
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000021370 protein_coding No protein product (NMD) view

Predicted translation: 

MWPTLRYVGGVCGLARYCVAGGFLRASGPASGVPGLLCGGGRRSSSTSSFDIVIVGGGIVGLASARTLILKHPGLSIGVV
EKEKDLANSSC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000113742 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000113730 FAD-dep_OxRdtase (36/406 aa) CDS CDS
ENSMUSE00000113733 FAD-dep_OxRdtase (51/406 aa) CDS Deleted
ENSMUSE00000113725 FAD-dep_OxRdtase (44/406 aa) CDS CDS + stop codon + UTR
ENSMUSE00000113723 FAD-dep_OxRdtase (55/406 aa) CDS
ENSMUSE00000305007 FAD-dep_OxRdtase (12/406 aa) CDS
ENSMUSE00000304999 FAD-dep_OxRdtase (56/406 aa) CDS
ENSMUSE00000113740 FAD-dep_OxRdtase (53/406 aa) CDS
ENSMUSE00000113736 FAD-dep_OxRdtase (45/406 aa) CDS
ENSMUSE00000334141 FAD-dep_OxRdtase (58/406 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 85376 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00092_Y_1_E05 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 85376 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00092_A_E05 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
85376 Knockout-First - Reporter Tagged Insertion PCS00092_A_E05
85376 Knockout-First - Reporter Tagged Insertion PCS00092_B_E05