IKMC Project Report - EUCOMM (ID: 48464)

Zbtb2 MGI:2685949 ENSMUSG00000075327
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000100078 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MDLTNHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQT

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000645007 UTR UTR
ENSMUSE00000645006 BTB_POZ (44/76 aa) UTR + start codon + CDS
ENSMUSE00000905791 BTB_POZ (33/76 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000100077 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MDLTNHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQT

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000645004 UTR UTR
ENSMUSE00000645006 BTB_POZ (44/76 aa) UTR + start codon + CDS
ENSMUSE00000901288 BTB_POZ (33/76 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available