IKMC Project Report - KOMP-CSD (ID: 48758)

Edil3 MGI:1329025 ENSMUSG00000034488 OTTMUSG00000027759
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Microinjection in progress

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000081769 protein_coding No protein product (NMD) view

Predicted translation: 

MKHLVAAWLLVGLSLGVPQFGKGDICNPNPCENGGICLSGLADDSFSCECPEGFAGPNCSSVVEVASDEEKPTSAGPCIP
NPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYNKFA
KKNESHWCYYPRSKKDWKPRVHKILQNCLQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000402542 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047442 EGF-like_dom (33/33 aa) CDS CDS
ENSMUSE00000963621 CDS CDS
ENSMUSE00001031118 EGF-like_dom (38/38 aa) | EGF_extracell (36/36 aa) CDS CDS
ENSMUSE00001065709 EGF_extracell (32/32 aa) CDS CDS
ENSMUSE00000229622 Coagulation_fac_5/8-C_type_dom (44/139 aa) CDS Deleted
ENSMUSE00000229613 Coagulation_fac_5/8-C_type_dom (52/139 aa) CDS CDS + stop codon + UTR
ENSMUSE00000229604 Coagulation_fac_5/8-C_type_dom (43/139 aa) CDS
ENSMUSE00000229597 Coagulation_fac_5/8-C_type_dom (45/140 aa) CDS
ENSMUSE00000229585 Coagulation_fac_5/8-C_type_dom (52/140 aa) CDS
ENSMUSE00000412574 Coagulation_fac_5/8-C_type_dom (43/140 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000043111 protein_coding No protein product (NMD) view

Predicted translation: 

MKHLVAAWLLVGLSLGVPQFGKGDICNPNPCENGGICLSGLADDSFSCECPEGFAGPNCSSVVEVGPCIPNPCHNGGTCE
ISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYNKFAKKNESHWCYY
PRSKKDWKPRVHKILQNCLQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000730283 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047442 EGF-like_dom (33/33 aa) CDS CDS
ENSMUSE00001031118 EGF-like_dom (38/38 aa) | EGF_extracell (36/36 aa) CDS CDS
ENSMUSE00001065709 EGF_extracell (32/32 aa) CDS CDS
ENSMUSE00000229622 Coagulation_fac_5/8-C_type_dom (44/139 aa) CDS Deleted
ENSMUSE00000229613 Coagulation_fac_5/8-C_type_dom (52/139 aa) CDS CDS + stop codon + UTR
ENSMUSE00000229604 Coagulation_fac_5/8-C_type_dom (43/139 aa) CDS
ENSMUSE00000229597 Coagulation_fac_5/8-C_type_dom (45/140 aa) CDS
ENSMUSE00000229585 Coagulation_fac_5/8-C_type_dom (52/140 aa) CDS
ENSMUSE00000412574 Coagulation_fac_5/8-C_type_dom (43/140 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000118731 protein_coding No protein product (NMD) view

Predicted translation: 

MKHLVAAWLLVGLSLGVPQFGKGDICNPNPCENGGICLSGLADDSFSCECPEGFAGPNCSSVVEVASDEEKPTSAGPCIP
NPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYNKFA
KKNESHWCYYPRSKKDWKPRVHKILQNCLQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000718055 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047442 EGF-like_dom (33/33 aa) CDS CDS
ENSMUSE00000963621 CDS CDS
ENSMUSE00001031118 EGF-like_dom (38/38 aa) | EGF_extracell (36/36 aa) CDS CDS
ENSMUSE00001065709 EGF_extracell (32/32 aa) CDS CDS
ENSMUSE00000229622 Coagulation_fac_5/8-C_type_dom (44/139 aa) CDS Deleted
ENSMUSE00000229613 Coagulation_fac_5/8-C_type_dom (52/139 aa) CDS CDS + stop codon + UTR
ENSMUSE00000229604 Coagulation_fac_5/8-C_type_dom (43/139 aa) CDS
ENSMUSE00000229597 CDS
ENSMUSE00000708388 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000137921 retained_intron Target region does not overlap transcript
ENSMUST00000140625 retained_intron Target region does not overlap transcript
ENSMUST00000153974 processed_transcript No analysis available: incomplete transcript
ENSMUST00000133761 processed_transcript Target region does not overlap transcript
ENSMUST00000134241 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0626_3_F05 HTGR01006_A_4_F09 Edil3tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0626_3_G07 HTGR01006_A_4_F09 Edil3tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0626_3_B05 HTGR01006_A_4_F09 Edil3tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0626_3_D05 HTGR01006_A_4_F09 Edil3tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0626_3_C06 HTGR01006_A_4_F09 Edil3tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0626_3_F07 HTGR01006_A_4_F09 Edil3tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0626_3_F06 HTGR01006_A_4_F09 Edil3tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0626_3_G08 HTGR01006_A_4_F09 Edil3tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45853 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR01006_C_4_F09 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 45853 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR01006_C_3_F09 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 45853 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS01006_A_F09 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 45853 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR01006_A_2_F09 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 45853 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR01006_C_2_F09 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 45853 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR01006_C_1_F09 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 45853 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR01006_A_1_F09 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 45853 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR01006_A_4_F09 L1L2_Pgk_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45853 Knockout-First - Reporter Tagged Insertion PCS00058_A_H10