IKMC Project Report - KOMP-CSD (ID: 48809)

Xaf1 MGI:3772572 ENSMUSG00000040483 OTTMUSG00000006106
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000146233 protein_coding Residual C-terminal product view

Predicted translation: 

MCLSAKGRPEEGKRIVSSPGRKTRCDLCKQMIPENTYASHMKQCSAPNTVTRIRDESIIVIPSTLAFMDSGNRRSTVSKD
VRPKTKNRNSSTKRETKKQNGTVALPLKSGLQQRADLPTGDETAYDTLQNCCQCRILLPLPILNEHQEKCQRLAHQKKLQ
WGW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000733871 UTR + start codon + CDS
ENSMUSE00000972996 CDS Deleted
ENSMUSE00001052786 CDS UTR + start codon + CDS
ENSMUSE00001080598 CDS CDS
ENSMUSE00000736845 CDS CDS
ENSMUSE00000789529 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000151440 protein_coding Novel C-terminal product view

Predicted translation: 

MDSGNRRSTVSKDVRPKTKNRNSSTKRETKKQNGTVALPLKSGLQQRADLPTGDETAYDTLQNCCQCRILLPLPILNEHQ
VLCSPCIPNCLLSCLGTCCSVLKHPSLASQCVAPPVPPSASVSLC

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000804731 UTR + start codon + CDS
ENSMUSE00000972996 CDS Deleted
ENSMUSE00000769380 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000140842 protein_coding Residual C-terminal product view

Predicted translation: 

MDSGNRRSTVSKDVRPKTKNRNSSTKRETKKQNGTVALPLKSGLQQRADLPTGDETAYDTLQNCCQCRILLPLPILNEHQ
EKCQRLAHQKKLQWGW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000892160 UTR + start codon + CDS
ENSMUSE00000972996 CDS Deleted
ENSMUSE00000736845 CDS UTR + start codon + CDS
ENSMUSE00000563258 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000094041 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000142921 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 38005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR01006_C_4_A08 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 38005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR01006_C_3_A08 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 38005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR01006_A_4_A08 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 38005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR01006_A_3_A08 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 38005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR01006_A_1_A08 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 38005 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS01006_A_A08 L1L2_Pgk_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
38005 Knockout First, Reporter-tagged insertion with conditional potential PCS00028_A_H11