IKMC Project Report - KOMP-CSD (ID: 49302)

Zfp449 MGI:1925869 ENSMUSG00000073176 OTTMUSG00000017518
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000101560 protein_coding No protein product (NMD) view

Predicted translation:

MAVALGCAIQASLNQGSVLQEYDTDCEVFRQRFRQFQYTEAAGPHEAFNKLWELCCQWLKPKMRSKEQILELLVLEQFLT
ILPTEIETWVREHCPDNRERVVSLIEDLQRELEIPEPQVISYQSLT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000655800 UTR UTR
ENSMUSE00000655799 Tscrpt_reg_SCAN (92/92 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000655796 CDS Deleted
ENSMUSE00000655794 CDS CDS + stop codon + UTR
ENSMUSE00000655790 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available