IKMC Project Report - KOMP-CSD (ID: 49401)

1700012A03Rik MGI:1923632 ENSMUSG00000029766 OTTMUSG00000014742
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000031778 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MDTDMRRAYTVIHSRVHASWQGCVDLQELSTE

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000774655 UTR UTR
ENSMUSE00000370082 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000972846 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000135066 processed_transcript No analysis available: incomplete transcript
ENSMUST00000156267 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 99241 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00109_X_3_G01 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 99241 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00109_D_G01 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 99241 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00109_X_4_G01 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
99241 Knockout-First - Reporter Tagged Insertion PCS00109_A_G01
99241 Knockout-First - Reporter Tagged Insertion PCS00109_C_G01