IKMC Project Report - EUCOMM (ID: 49404)

Sostdc1 MGI:1913292 ENSMUSG00000036169
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000041407 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MLPPAIHLSLIPLLCILMRNCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSSTGLDRN

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000324406 Sclerostin (63/201 aa) | DAN (5/105 aa) UTR + start codon + CDS
ENSMUSE00000324397 Sclerostin (138/201 aa) | Cys_knot (104/104 aa) | DAN (101/105 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 87432 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00092_W_1_C12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 87432 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00092_W_2_B12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 87432 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00092_C_B12 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
87432 Knockout-First - Reporter Tagged Insertion PCS00092_A_B12
87432 Knockout-First - Reporter Tagged Insertion PCS00092_C_B12