IKMC Project Report - EUCOMM (ID: 49440)

Kansl2 MGI:1916862 ENSMUSG00000022992
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000116400 protein_coding No protein product (NMD) view

Predicted translation:

MNRIRIHVLPTNRGRITPVPRSQEPLSCSFTHRPCSQPRLEGQEFCIKHILEDKNAPFKQCSYVSTKNGKRCPSAAPKPE
KKDGVSFCAEHARRNALALHAQMKKSNPGPMGETLLCQLSSYAKTELGSQTPESSRSEASRILDEDSWSDGDQEPITVDQ
TWRGDPDSEADSIDSDQEDPLKLTPLVPVRGA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000911112 UTR UTR
ENSMUSE00000915086 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000551497 CDS CDS
ENSMUSE00000132440 CDS CDS
ENSMUSE00000132442 CDS Deleted
ENSMUSE00000429352 CDS Deleted
ENSMUSE00000551491 CDS CDS + stop codon + UTR
ENSMUSE00000551487 CDS
ENSMUSE00000551486 CDS
ENSMUSE00000666575 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000023727 protein_coding No protein product (NMD) view

Predicted translation:

MNRIRIHVLPTNRGRITPVPRSQEPLSCSFTHRPCSQPRLEGQEFCIKHILEDKNAPFKQCSYVSTKNGKRCPSAAPKPE
KKDGVSFCAEHARRNALALHAQMKKSNPGPMGETLLCQLSSYAKTELGSQTPESSRSEASRILDEDSWSDGDQEPITVDQ
TWRGDPDSEADSIDSDQEDPLKLTPLVPVRGA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000270853 UTR UTR
ENSMUSE00000915086 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000551497 CDS CDS
ENSMUSE00000132440 CDS CDS
ENSMUSE00000706192 CDS Deleted
ENSMUSE00000896847 CDS Deleted
ENSMUSE00000551491 CDS CDS + stop codon + UTR
ENSMUSE00000897859 CDS
ENSMUSE00000551486 CDS
ENSMUSE00000594172 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 84875 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00092_W_3_A04 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 84875 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00092_C_A04 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 84875 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00092_W_4_A04 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
84875 Knockout First, Reporter-tagged insertion with conditional potential PCS00092_A_A04
84875 Knockout First, Reporter-tagged insertion with conditional potential PCS00092_C_A04