IKMC Project Report - KOMP-CSD (ID: 50112)

Kcnc1 MGI:96667 ENSMUSG00000058975 OTTMUSG00000034762
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000160433 protein_coding No protein product (NMD) view

Predicted translation:

MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPA
DVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDS
PDGRPGGFWRRWQPRIWALFEDPYSSRYARIPN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000505576 T1-type_BTB (95/95 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000634674 Ion_trans_dom (188/188 aa) | Ion_trans_2 (84/84 aa) CDS Deleted
ENSMUSE00000634673 CDS CDS + stop codon + UTR
ENSMUSE00000849308 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000025202 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPA
DVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDS
PDGRPGGFWRRWQPRIWALFEDPYSSRYAR

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000634676 T1-type_BTB (95/95 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000634675 Ion_trans_dom (188/188 aa) | Ion_trans_2 (84/84 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000160234 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 94178 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00100_W_1_A04 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 94178 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00100_W_4_A04 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 94178 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00100_W_3_A04 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 94178 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00100_C_A04 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
94178 Knockout First, Reporter-tagged insertion with conditional potential PCS00100_A_A04
94178 Knockout First, Reporter-tagged insertion with conditional potential PCS00100_D_A04