IKMC Project Report - KOMP-CSD (ID: 50168)

Guf1 MGI:2140726 ENSMUSG00000029208 OTTMUSG00000027761
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000087228 protein_coding No protein product (NMD) view

Predicted translation: 

MWALVGRALAPWAAGARHAAASEPRAACRLFSAAELKEKPDMSRFPVEDIRNFSIIAHVDHGKSTLADRLLELTGTIDKT
KKNKQVLDKLQVERERGITVKAQTASLFYSFGGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEGIQAQTVAN
FFLAFEAQLSVIPVINKIDLKNADPERVGKQIEKVFDIPSEECIKSKSPS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001004897 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000987158 ProtSyn_GTP-bd (26/178 aa) CDS CDS
ENSMUSE00001014748 ProtSyn_GTP-bd (50/178 aa) | Small_GTPase (27/129 aa) CDS CDS
ENSMUSE00001093286 ProtSyn_GTP-bd (27/178 aa) | Small_GTPase (27/129 aa) CDS CDS
ENSMUSE00001042261 ProtSyn_GTP-bd (26/178 aa) | Small_GTPase (26/129 aa) CDS CDS
ENSMUSE00001002658 ProtSyn_GTP-bd (28/178 aa) | Small_GTPase (28/129 aa) CDS CDS
ENSMUSE00001034050 ProtSyn_GTP-bd (22/178 aa) | Small_GTPase (21/129 aa) CDS Deleted
ENSMUSE00001028766 ProtSyn_GTP-bd (1/178 aa) | Transl_elong_EFTu/EF1A_2 (45/71 aa) CDS CDS + stop codon + UTR
ENSMUSE00000186918 Transl_elong_EFTu/EF1A_2 (27/71 aa) CDS
ENSMUSE00001000585 CDS
ENSMUSE00001027289 CDS
ENSMUSE00001023280 Transl_elong_EFG/EF2_C (24/88 aa) CDS
ENSMUSE00001068661 Transl_elong_EFG/EF2_C (45/88 aa) CDS
ENSMUSE00000186914 LepA_GTP-bd_C (14/108 aa) | Transl_elong_EFG/EF2_C (20/88 aa) CDS
ENSMUSE00001031822 LepA_GTP-bd_C (41/108 aa) CDS
ENSMUSE00001051183 LepA_GTP-bd_C (13/108 aa) CDS
ENSMUSE00000598813 LepA_GTP-bd_C (42/108 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000031113 protein_coding No protein product (NMD) view

Predicted translation: 

MWALVGRALAPWAAGARHAAASEPRAACRLFSAAELKEKPDMSRFPVEDIRNFSIIAHVDHGKSTLADRLLELTGTIDKT
KKNKQVLDKLQVERERGITVKAQTASLFYSFGGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEGIQAQTVAN
FFLAFEAQLSVIPVINKIDLKNADPERVGKQIEKVFDIPSEECIKSKSPS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000842892 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000987158 ProtSyn_GTP-bd (26/178 aa) CDS CDS
ENSMUSE00001014748 ProtSyn_GTP-bd (50/178 aa) | Small_GTPase (28/130 aa) CDS CDS
ENSMUSE00001093286 ProtSyn_GTP-bd (27/178 aa) | Small_GTPase (27/130 aa) CDS CDS
ENSMUSE00001042261 ProtSyn_GTP-bd (26/178 aa) | Small_GTPase (26/130 aa) CDS CDS
ENSMUSE00001002658 ProtSyn_GTP-bd (28/178 aa) | Small_GTPase (28/130 aa) CDS CDS
ENSMUSE00001034050 ProtSyn_GTP-bd (22/178 aa) | Small_GTPase (21/130 aa) CDS Deleted
ENSMUSE00001028766 ProtSyn_GTP-bd (1/178 aa) CDS CDS + stop codon + UTR
ENSMUSE00001027289 CDS
ENSMUSE00001023280 Transl_elong_EFG/EF2_C (24/88 aa) CDS
ENSMUSE00001068661 Transl_elong_EFG/EF2_C (45/88 aa) CDS
ENSMUSE00000186914 LepA_GTP-bd_C (14/108 aa) | Transl_elong_EFG/EF2_C (20/88 aa) CDS
ENSMUSE00001031822 LepA_GTP-bd_C (41/108 aa) CDS
ENSMUSE00001051183 LepA_GTP-bd_C (13/108 aa) CDS
ENSMUSE00000753551 LepA_GTP-bd_C (42/108 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000173205 protein_coding No analysis available: incomplete transcript
ENSMUST00000144363 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000125660 retained_intron Target region does not overlap transcript
ENSMUST00000154728 retained_intron No analysis available: incomplete transcript
ENSMUST00000125543 retained_intron No analysis available: incomplete transcript
ENSMUST00000132169 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0660_4_F08 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_C07 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity fail
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_E07 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_E07 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_H05 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_C08 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number fail Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_E08 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_F05 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_D08 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_G06 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_G05 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_E06 PG00120_Z_3_A05 Guf1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0660_4_D07 PG00120_Z_3_A05 Guf1tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0660_4_B08 PG00120_Z_3_A05 Guf1tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 113065 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00120_Z_3_A05 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 113065 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00120_A_A05 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 113065 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00120_Z_4_A05 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 113065 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00120_Z_2_A05 L1L2_Pgk_P L3L4_pD223_DTA_spec view
order 113065 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00120_Z_1_A05 L1L2_Pgk_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
113065 Knockout-First - Reporter Tagged Insertion PCS00120_B_A05