IKMC Project Report - EUCOMM (ID: 65469)

Oas1b MGI:97430 ENSMUSG00000029605
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000086377 protein_coding No protein product (NMD) view

Predicted translation:

MEQDLRSIPASKLDKFIENHLPDTSFCADLREVIDALCALLKDRSFRGPVRRMRASKGVKIILTSSRSLTNNSTPISSVA
YPPGRRASYRSALWGFRSTS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000885515 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001058453 CDS Deleted
ENSMUSE00000875776 2-5-oligoAdlate_synth_1_dom2/C (12/93 aa) CDS CDS
ENSMUSE00000986562 CDS CDS
ENSMUSE00001080027 CDS CDS
ENSMUSE00000912345 2-5-oligoAdlate_synth_1_dom2/C (38/93 aa) CDS CDS + stop codon + UTR
ENSMUSE00001023430 2-5-oligoAdlate_synth_1_dom2/C (38/93 aa) CDS + stop codon + UTR
ENSMUSE00000538650 UTR UTR
ENSMUSE00000911088 UTR UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available