IKMC Project Report - NorCOMM (ID: 65635)

Dlg3 MGI:1888986 ENSMUSG00000000881 OTTMUSG00000016499
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000087984 protein_coding No protein product (NMD) view

Predicted translation: 

MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGR
DVGPVPPKPVPGKSTPKLNGSGPGWWPECTCTNRDWYEQSTVALNPRSMTCGNK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000549357 MAGUK_PEST_N (69/99 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000207980 MAGUK_PEST_N (18/99 aa) CDS Deleted
ENSMUSE00001006978 PDZ (4/83 aa) | MAGUK_PEST_N (12/99 aa) CDS Deleted
ENSMUSE00001064190 PDZ (42/83 aa) CDS Deleted
ENSMUSE00001070947 PDZ (38/83 aa) | PDZ (8/83 aa) CDS Deleted
ENSMUSE00000549384 PDZ (46/83 aa) CDS Deleted
ENSMUSE00000207965 PDZ (30/83 aa) | PDZ_assoc (18/75 aa) CDS Deleted
ENSMUSE00000976794 PDZ_assoc (54/75 aa) CDS Deleted
ENSMUSE00001037316 PDZ (47/76 aa) | PDZ_assoc (5/75 aa) CDS Deleted
ENSMUSE00001034194 PDZ (29/76 aa) CDS Deleted
ENSMUSE00001082505 SH3_2 (2/63 aa) CDS CDS + stop codon + UTR
ENSMUSE00001004401 SH3_domain (57/57 aa) | SH3_2 (60/63 aa) CDS
ENSMUSE00001076099 SH3_2 (3/63 aa) CDS
ENSMUSE00000289703 CDS
ENSMUSE00000992389 CDS
ENSMUSE00000991633 CDS
ENSMUSE00001001242 Guanylate_kin (31/177 aa) CDS
ENSMUSE00000973886 Guanylate_kin (58/177 aa) CDS
ENSMUSE00000990275 Guanylate_kin (37/177 aa) CDS
ENSMUSE00000979371 Guanylate_kin (32/177 aa) CDS
ENSMUSE00001049145 Guanylate_kin (22/177 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000113736 protein_coding No protein product (NMD) view

Predicted translation: 

MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGR
DVGPVPPKPVPGKSTPKLNGSGPGWWPECTCTNRDWYEQSTVALNPRSMTCGNK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000819534 MAGUK_PEST_N (69/99 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000207980 MAGUK_PEST_N (18/99 aa) CDS Deleted
ENSMUSE00001006978 PDZ (4/83 aa) | MAGUK_PEST_N (12/99 aa) CDS Deleted
ENSMUSE00001064190 PDZ (42/83 aa) CDS Deleted
ENSMUSE00001070947 PDZ (38/83 aa) | PDZ (8/83 aa) CDS Deleted
ENSMUSE00000549384 PDZ (46/83 aa) CDS Deleted
ENSMUSE00000207965 PDZ (30/83 aa) | PDZ_assoc (18/75 aa) CDS Deleted
ENSMUSE00000976794 PDZ_assoc (54/75 aa) CDS Deleted
ENSMUSE00001037316 PDZ (47/76 aa) | PDZ_assoc (5/75 aa) CDS Deleted
ENSMUSE00001034194 PDZ (29/76 aa) CDS Deleted
ENSMUSE00001082505 SH3_2 (2/63 aa) CDS CDS + stop codon + UTR
ENSMUSE00001004401 SH3_domain (57/57 aa) | SH3_2 (60/63 aa) CDS
ENSMUSE00001076099 SH3_2 (3/63 aa) CDS
ENSMUSE00000289703 CDS
ENSMUSE00000991633 CDS
ENSMUSE00001001242 Guanylate_kin (31/177 aa) CDS
ENSMUSE00000973886 Guanylate_kin (58/177 aa) CDS
ENSMUSE00000990275 Guanylate_kin (37/177 aa) CDS
ENSMUSE00000979371 Guanylate_kin (32/177 aa) CDS
ENSMUSE00001049145 Guanylate_kin (22/177 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000113735 protein_coding Design floxes first exon in transcript ENSMUST00000113735
ENSMUST00000000901 protein_coding No protein product (NMD) view

Predicted translation: 

MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGR
DVGPVPPKPVPGKSTPKLNGSGPGWWPECTCTNRDWYEQSTVALNPRSMTCGNK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000761887 MAGUK_PEST_N (69/72 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001006978 PDZ (4/83 aa) | MAGUK_PEST_N (3/72 aa) CDS Deleted
ENSMUSE00001064190 PDZ (42/83 aa) CDS Deleted
ENSMUSE00001070947 PDZ (38/83 aa) | PDZ (8/83 aa) CDS Deleted
ENSMUSE00000549384 PDZ (46/83 aa) CDS Deleted
ENSMUSE00000207965 PDZ (30/83 aa) | PDZ_assoc (18/75 aa) CDS Deleted
ENSMUSE00000976794 PDZ_assoc (54/75 aa) CDS Deleted
ENSMUSE00001037316 PDZ (47/76 aa) | PDZ_assoc (5/75 aa) CDS Deleted
ENSMUSE00001034194 PDZ (29/76 aa) CDS Deleted
ENSMUSE00001082505 SH3_2 (2/63 aa) CDS CDS + stop codon + UTR
ENSMUSE00001004401 SH3_domain (57/57 aa) | SH3_2 (60/63 aa) CDS
ENSMUSE00001076099 SH3_2 (3/63 aa) CDS
ENSMUSE00000289703 CDS
ENSMUSE00000991633 CDS
ENSMUSE00001001242 Guanylate_kin (31/177 aa) CDS
ENSMUSE00000973886 Guanylate_kin (58/177 aa) CDS
ENSMUSE00000990275 Guanylate_kin (37/177 aa) CDS
ENSMUSE00000979371 Guanylate_kin (32/177 aa) CDS
ENSMUSE00000798025 Guanylate_kin (22/177 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000147863 retained_intron No analysis available: incomplete transcript
ENSMUST00000151020 processed_transcript Target region does not overlap transcript
ENSMUST00000146772 processed_transcript Target region does not overlap transcript
ENSMUST00000148076 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01651P1_C_249W_A10 N01651P1_T_169.32_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01651P1_C_249W_A12 N01651P1_T_169.32_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01651P1_C_249W_C10 N01651P1_T_169.32_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01651P1_C_249W_E10 N01651P1_T_169.32_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01651P1_C_249W_F10 N01651P1_T_169.32_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01651P1_C_249W_G10 N01651P1_T_169.32_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01651P1_C_249W_G11 N01651P1_T_169.32_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01651P1_C_249W_H10 N01651P1_T_169.32_B07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 232070 Deletion (Promotor Driven Cassette) N01651P1_T_169.32_B07 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
232070 Deletion N01651P1_I_169.32_B07