IKMC Project Report - NorCOMM (ID: 65729)

Jak1 MGI:96628 ENSMUSG00000028530 OTTMUSG00000008208
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000102781 protein_coding No protein product (NMD) view

Predicted translation:

MQYLNIKEDCNAMAFCAKMRSFKKTEVKQVVPEPGVEVTFYLLDREPLRLGSGEYTAEELCIRAAQECRTV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000662588 UTR UTR
ENSMUSE00001008976 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000662586 CDS CDS
ENSMUSE00001063061 CDS Deleted
ENSMUSE00001023510 CDS Deleted
ENSMUSE00000990003 CDS CDS + stop codon + UTR
ENSMUSE00000179879 CDS
ENSMUSE00000179868 CDS
ENSMUSE00000179873 CDS
ENSMUSE00000279282 CDS
ENSMUSE00000279276 CDS
ENSMUSE00000279267 CDS
ENSMUSE00000662585 Ser-Thr/Tyr_kinase_cat_dom (48/260 aa) | Prot_kinase_cat_dom (47/258 aa) CDS
ENSMUSE00000179886 Ser-Thr/Tyr_kinase_cat_dom (30/260 aa) | Prot_kinase_cat_dom (30/258 aa) CDS
ENSMUSE00000179882 Ser-Thr/Tyr_kinase_cat_dom (43/260 aa) | Prot_kinase_cat_dom (43/258 aa) CDS
ENSMUSE00000179885 Ser-Thr/Tyr_kinase_cat_dom (46/260 aa) | Prot_kinase_cat_dom (46/258 aa) CDS
ENSMUSE00000179866 Ser-Thr/Tyr_kinase_cat_dom (51/260 aa) | Prot_kinase_cat_dom (51/258 aa) CDS
ENSMUSE00000179867 Ser-Thr/Tyr_kinase_cat_dom (44/260 aa) | Prot_kinase_cat_dom (43/258 aa) CDS
ENSMUSE00000662584 Ser-Thr/Tyr_kinase_cat_dom (7/272 aa) | Prot_kinase_cat_dom (6/271 aa) CDS
ENSMUSE00000179869 Ser-Thr/Tyr_kinase_cat_dom (65/272 aa) | Prot_kinase_cat_dom (65/271 aa) CDS
ENSMUSE00000179874 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/271 aa) CDS
ENSMUSE00000179878 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/271 aa) CDS
ENSMUSE00000179884 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/271 aa) CDS
ENSMUSE00000179864 Ser-Thr/Tyr_kinase_cat_dom (37/272 aa) | Prot_kinase_cat_dom (37/271 aa) CDS
ENSMUSE00000662583 Ser-Thr/Tyr_kinase_cat_dom (25/272 aa) | Prot_kinase_cat_dom (25/271 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000149297 protein_coding Target region does not overlap transcript
ENSMUST00000147211 processed_transcript No analysis available: incomplete transcript
ENSMUST00000132292 processed_transcript No analysis available: incomplete transcript
ENSMUST00000155328 processed_transcript No analysis available: incomplete transcript
ENSMUST00000136167 processed_transcript No analysis available: incomplete transcript
ENSMUST00000151235 processed_transcript Target region does not overlap transcript
ENSMUST00000125968 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01337P1_C_61T_D3 N01337P1_T_172.3_F01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01337P1_C_61T_H6 N01337P1_T_172.3_F01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 232935 Deletion (Promotor Driven Cassette) N01337P1_T_172.3_F01 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
232935 Deletion N01337P1_I_172.3_F01