IKMC Project Report - NorCOMM (ID: 65737)

Akr7a5 MGI:107796 ENSMUSG00000028743 OTTMUSG00000009905
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000073787 protein_coding No protein product (NMD) view

Predicted translation: 

MLRAASRAVGRAAVRSAQRSGTSVGRPLAMSRPPPPRAASGAPLRPATVLGTMEMGRRMDASASAASVRAFLERGHSELD
TAFMYCDGQSENILGGLGLGLGSGDCTGHVQRHHPAGGGRAPPLPQTLRTEVLRLQPFGWGPADWQV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000460676 NADP_OxRdtase_dom (59/307 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000283630 NADP_OxRdtase_dom (63/307 aa) CDS Deleted
ENSMUSE00000283623 NADP_OxRdtase_dom (35/307 aa) CDS Deleted
ENSMUSE00000283614 NADP_OxRdtase_dom (33/307 aa) CDS CDS
ENSMUSE00000181766 NADP_OxRdtase_dom (34/307 aa) CDS CDS + stop codon + UTR
ENSMUSE00000181763 NADP_OxRdtase_dom (44/307 aa) CDS
ENSMUSE00000630825 NADP_OxRdtase_dom (42/307 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153645 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01348P1_C_101W_A2 N01348P1_T_172.1_G09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01348P1_C_101W_B1 N01348P1_T_172.1_G09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01348P1_C_101W_B2 N01348P1_T_172.1_G09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01348P1_C_101W_C2 N01348P1_T_172.1_G09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01348P1_C_101W_D2 N01348P1_T_172.1_G09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01348P1_C_101W_E1 N01348P1_T_172.1_G09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01348P1_C_101W_E2 N01348P1_T_172.1_G09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01348P1_C_101W_E3 N01348P1_T_172.1_G09 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 227423 Deletion (Promotor Driven Cassette) N01348P1_T_172.1_G09 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
227423 Deletion N01348P1_I_172.1_G09