IKMC Project Report - NorCOMM (ID: 65757)

Acvr2a MGI:102806 ENSMUSG00000052155 OTTMUSG00000012394
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000063886 protein_coding No protein product (NMD) view

Predicted translation: 

MGAAAKLAFAVFLISCSSGPRTTPTFPITRVEAIAAVRSESKGKIWLCLESPVAQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000758336 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000389709 Activin_rcpt (36/65 aa) CDS Deleted
ENSMUSE00000162461 Activin_rcpt (30/65 aa) CDS Deleted
ENSMUSE00000162458 CDS Deleted
ENSMUSE00000162460 Prot_kinase_cat_dom (31/283 aa) | Ser-Thr/Tyr_kinase_cat_dom (26/274 aa) CDS CDS + stop codon + UTR
ENSMUSE00001087427 Prot_kinase_cat_dom (48/283 aa) | Ser-Thr/Tyr_kinase_cat_dom (48/274 aa) CDS
ENSMUSE00001083044 Prot_kinase_cat_dom (49/283 aa) | Ser-Thr/Tyr_kinase_cat_dom (49/274 aa) CDS
ENSMUSE00001055396 Prot_kinase_cat_dom (39/283 aa) | Ser-Thr/Tyr_kinase_cat_dom (39/274 aa) CDS
ENSMUSE00001093516 Prot_kinase_cat_dom (47/283 aa) | Ser-Thr/Tyr_kinase_cat_dom (47/274 aa) CDS
ENSMUSE00000162457 Prot_kinase_cat_dom (44/283 aa) | Ser-Thr/Tyr_kinase_cat_dom (44/274 aa) CDS
ENSMUSE00000837469 Prot_kinase_cat_dom (27/283 aa) | Ser-Thr/Tyr_kinase_cat_dom (23/274 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000156681 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01375P1_C_102W_D4 N01375P1_T_172.3_F07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01375P1_C_102W_F5 N01375P1_T_172.3_F07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01375P1_C_102W_G2 N01375P1_T_172.3_F07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01375P1_C_102W_G3 N01375P1_T_172.3_F07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 233016 Deletion (Promotor Driven Cassette) N01375P1_T_172.3_F07 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
233016 Deletion N01375P1_I_172.3_F07