IKMC Project Report - NorCOMM (ID: 65778)

Grin2a MGI:95820 ENSMUSG00000059003 OTTMUSG00000016264
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000115835 protein_coding No protein product (NMD) view

Predicted translation: 

MGRLGYWTLLVLPALLVWHGPAQNAAAEKGTPALNIAVLLGHSHDVTERELRNLWGPEQATGLPLDVNVVALLMNRTDPK
SLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQTFIPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLK
IMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILTTAASSMLEKFSYIPEAKASC
YGQTEKPETPLHTLHQWASGRIRL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000704329 UTR UTR
ENSMUSE00000704328 UTR UTR
ENSMUSE00000704327 ANF_lig-bd_rcpt (31/159 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000506617 ANF_lig-bd_rcpt (128/159 aa) CDS CDS
ENSMUSE00000509490 CDS Deleted
ENSMUSE00000467100 CDS CDS + stop codon + UTR
ENSMUSE00000466675 SBP_bac_3 (42/341 aa) | Glu_rcpt_Glu/Gly-bd (52/55 aa) CDS
ENSMUSE00000196394 SBP_bac_3 (52/341 aa) | Glu_rcpt_Glu/Gly-bd (3/55 aa) CDS
ENSMUSE00000461077 Iontro_glu_rcpt (38/274 aa) | SBP_bac_3 (43/341 aa) CDS
ENSMUSE00000464010 Iontro_glu_rcpt (77/274 aa) | SBP_bac_3 (77/341 aa) CDS
ENSMUSE00000462658 Iontro_glu_rcpt (54/274 aa) | SBP_bac_3 (54/341 aa) CDS
ENSMUSE00000563770 Iontro_glu_rcpt (64/274 aa) | SBP_bac_3 (64/341 aa) CDS
ENSMUSE00000518308 NMDAR2_C (26/626 aa) | Iontro_glu_rcpt (44/274 aa) | SBP_bac_3 (13/341 aa) CDS
ENSMUSE00000472391 NMDAR2_C (599/626 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000032331 protein_coding No analysis available: incomplete transcript
ENSMUST00000156482 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01398P1_C_91W_B3 N01398P1_T_172.3_D02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01398P1_C_91W_H2 N01398P1_T_172.3_D02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01398P1_C_91W_H6 N01398P1_T_172.3_D02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 227585 Deletion (Promotor Driven Cassette) N01398P1_T_172.3_D02 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
227585 Deletion N01398P1_I_172.3_D02