IKMC Project Report - NorCOMM (ID: 65829)

Atp6ap1 MGI:109629 ENSMUSG00000019087 OTTMUSG00000017676
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000019231 protein_coding No protein product (NMD) view

Predicted translation:

MMAATVVSRIRTGTGRAPVMWLSLSLVAVAAAVATEQQVPLVLWSSDRNLWAPVADTHEGHITSDMQLSTYLDPALELGP
RNVLLFLQDKMRSSDRY*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000768503 BIG/ATPase_V1_suS1 (10/405 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001087461 BIG/ATPase_V1_suS1 (43/405 aa) CDS CDS
ENSMUSE00001084107 BIG/ATPase_V1_suS1 (25/405 aa) CDS Deleted
ENSMUSE00001053899 BIG/ATPase_V1_suS1 (65/405 aa) CDS Deleted
ENSMUSE00001066470 BIG/ATPase_V1_suS1 (15/405 aa) CDS Deleted
ENSMUSE00000975983 BIG/ATPase_V1_suS1 (29/405 aa) CDS CDS + stop codon + UTR
ENSMUSE00001006639 BIG/ATPase_V1_suS1 (80/405 aa) CDS
ENSMUSE00000997202 BIG/ATPase_V1_suS1 (17/405 aa) CDS
ENSMUSE00000209161 BIG/ATPase_V1_suS1 (77/405 aa) CDS
ENSMUSE00000354479 BIG/ATPase_V1_suS1 (49/405 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114171 protein_coding No protein product (NMD) view

Predicted translation:

MMAATVVSRIRTGTGRAPVMWLSLSLVAVAAAVATEQQVPLVLWSSDRNLWAPVADTHEGHITSDMQLSTYLDPALELGP
RNVLLFLQDKMRSSDRY*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000727537 BIG/ATPase_V1_suS1 (10/357 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001087461 BIG/ATPase_V1_suS1 (43/357 aa) CDS CDS
ENSMUSE00001084107 BIG/ATPase_V1_suS1 (25/357 aa) CDS Deleted
ENSMUSE00001053899 BIG/ATPase_V1_suS1 (65/357 aa) CDS Deleted
ENSMUSE00001066470 BIG/ATPase_V1_suS1 (15/357 aa) CDS Deleted
ENSMUSE00000975983 BIG/ATPase_V1_suS1 (29/357 aa) CDS CDS + stop codon + UTR
ENSMUSE00001006639 BIG/ATPase_V1_suS1 (80/357 aa) CDS
ENSMUSE00000997202 BIG/ATPase_V1_suS1 (17/357 aa) CDS
ENSMUSE00000209161 BIG/ATPase_V1_suS1 (77/357 aa) CDS
ENSMUSE00000760832 BIG/ATPase_V1_suS1 (1/357 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000147275 protein_coding No analysis available: incomplete transcript
ENSMUST00000147900 protein_coding No analysis available: incomplete transcript
ENSMUST00000154630 protein_coding Target region does not overlap transcript
ENSMUST00000124797 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000136056 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000135914 retained_intron No analysis available: incomplete transcript
ENSMUST00000144506 retained_intron Target region does not overlap transcript
ENSMUST00000144075 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available