IKMC Project Report - NorCOMM (ID: 66014)

Desi2 MGI:1926075 ENSMUSG00000026502 OTTMUSG00000029657
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027783 protein_coding No protein product (NMD) view

Predicted translation: 

MGANQLVVLNVYDMSLLMVAIHILFLEYLKFPQEMLLS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000858063 DUF862_euk (7/143 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000987752 DUF862_euk (25/143 aa) CDS Deleted
ENSMUSE00000159955 DUF862_euk (32/143 aa) CDS CDS + stop codon + UTR
ENSMUSE00000159957 DUF862_euk (48/143 aa) CDS
ENSMUSE00000658594 DUF862_euk (33/143 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000161075 protein_coding Residual C-terminal product view

Predicted translation: 

MHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASSAMASAA
AGARTGRHTKL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000686823 UTR UTR
ENSMUSE00000858563 UTR UTR
ENSMUSE00000997712 DUF862_euk (19/130 aa) UTR + start codon + CDS Deleted
ENSMUSE00000159955 DUF862_euk (32/130 aa) CDS
ENSMUSE00000159957 DUF862_euk (48/130 aa) CDS UTR + start codon + CDS
ENSMUSE00000849890 DUF862_euk (33/130 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000159284 protein_coding Residual C-terminal product view

Predicted translation: 

MHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000849202 UTR UTR
ENSMUSE00000861728 UTR UTR
ENSMUSE00000866431 UTR UTR
ENSMUSE00000863917 UTR UTR
ENSMUSE00000997712 DUF862_euk (19/130 aa) UTR + start codon + CDS Deleted
ENSMUSE00000159955 DUF862_euk (32/130 aa) CDS
ENSMUSE00000159957 DUF862_euk (48/130 aa) CDS UTR + start codon + CDS
ENSMUSE00000859181 DUF862_euk (33/130 aa) CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01762P1_C_252W_D10 N01762P1_T_178.1_E01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01762P1_C_252W_E9 N01762P1_T_178.1_E01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01762P1_C_252W_F10 N01762P1_T_178.1_E01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01762P1_C_252W_G9 N01762P1_T_178.1_E01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 235603 Deletion (Promotor Driven Cassette) N01762P1_T_178.1_E01 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
235603 Deletion N01762P1_I_178.1_E01