IKMC Project Report - NorCOMM (ID: 66016)

Abca16 MGI:2388711 ENSMUSG00000051900 OTTMUSG00000029808
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000120490 protein_coding No protein product (NMD) view

Predicted translation:

MNQLTVNQLTVLLWKNFTLKGILRKDSWQYSMLWTRASCCIMKAVLGKSCLMKSTL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000470841 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000506178 CDS Deleted
ENSMUSE00000505166 CDS Deleted
ENSMUSE00001085486 CDS Deleted
ENSMUSE00001072270 CDS CDS + stop codon + UTR
ENSMUSE00000477387 CDS
ENSMUSE00000481533 CDS
ENSMUSE00001043556 CDS
ENSMUSE00000992803 CDS
ENSMUSE00000971751 CDS
ENSMUSE00000493722 ABC_transporter-like (17/121 aa) CDS
ENSMUSE00000492552 ABC_transporter-like (43/121 aa) CDS
ENSMUSE00000993385 ABC_transporter-like (52/121 aa) CDS
ENSMUSE00000985222 ABC_transporter-like (9/121 aa) CDS
ENSMUSE00000495297 CDS
ENSMUSE00000500949 CDS
ENSMUSE00000499924 CDS
ENSMUSE00000366352 CDS
ENSMUSE00000262139 CDS
ENSMUSE00000262131 CDS
ENSMUSE00000204746 CDS
ENSMUSE00000475448 CDS
ENSMUSE00000511729 CDS
ENSMUSE00000262106 CDS
ENSMUSE00000204704 ABC_transporter-like (30/119 aa) CDS
ENSMUSE00000204747 ABC_transporter-like (63/119 aa) CDS
ENSMUSE00000976094 ABC_transporter-like (27/119 aa) CDS
ENSMUSE00000334598 CDS
ENSMUSE00000485972 CDS
ENSMUSE00000485024 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000056042 protein_coding No protein product (NMD) view

Predicted translation:

MNQLTVNQLTVLLWKNFTLKGILRKDSWQYSMLWTRASCCIMKAVLGKSCLMKSTL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000470841 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000506178 CDS Deleted
ENSMUSE00000505166 CDS Deleted
ENSMUSE00001085486 CDS Deleted
ENSMUSE00001072270 CDS CDS + stop codon + UTR
ENSMUSE00000477387 CDS
ENSMUSE00000481533 CDS
ENSMUSE00000486967 CDS
ENSMUSE00000984689 CDS
ENSMUSE00000485026 CDS
ENSMUSE00000971751 CDS
ENSMUSE00000493722 ABC_transporter-like (17/121 aa) CDS
ENSMUSE00000492552 ABC_transporter-like (43/121 aa) CDS
ENSMUSE00000993385 ABC_transporter-like (52/121 aa) CDS
ENSMUSE00000985222 ABC_transporter-like (9/121 aa) CDS
ENSMUSE00000495297 CDS
ENSMUSE00000500949 CDS
ENSMUSE00000499924 CDS
ENSMUSE00000366352 CDS
ENSMUSE00000262139 CDS
ENSMUSE00000262131 CDS
ENSMUSE00000204746 CDS
ENSMUSE00000475448 CDS
ENSMUSE00000511729 CDS
ENSMUSE00000262106 CDS
ENSMUSE00000204704 ABC_transporter-like (30/119 aa) CDS
ENSMUSE00000204747 ABC_transporter-like (63/119 aa) CDS
ENSMUSE00000976094 ABC_transporter-like (27/119 aa) CDS
ENSMUSE00000334598 CDS
ENSMUSE00000485972 CDS
ENSMUSE00000485024 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000144122 nonsense_mediated_decay Residual C-terminal product view

Predicted translation:

MLYHESSAGKKLFDEIDTVIQRFPYPSHPQDKLLWISSPFIPLMFILMFSSIVLSIMRSIVFEKEKRLKEYQLIMGLRNW
IIWIGYFFTFFPLYVIIILLICILLFVQLVWLLLLETSYFLPVSFPIISSLNTMGC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000837825 UTR UTR
ENSMUSE00001049704 UTR Deleted
ENSMUSE00001034658 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000779692 CDS CDS
ENSMUSE00001067691 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001090023 UTR UTR
ENSMUSE00001074743 UTR UTR
ENSMUSE00000821866 UTR UTR
ENSMUSE00001043718 UTR UTR
ENSMUSE00000963788 UTR UTR
ENSMUSE00000823411 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000153845 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01766P1_C_90T_A8 N01766P1_T_178.2_F01 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 235748 Deletion (Promotor Driven Cassette) N01766P1_T_178.2_F01 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
235748 Deletion N01766P1_I_178.2_F01