IKMC Project Report - NorCOMM (ID: 66124)

Gc MGI:95669 ENSMUSG00000035540
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000049209 protein_coding No protein product (NMD) view

Predicted translation: 

MKRVLVLLLALAFGHALERGFCMSIPAIMDKRLCHF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000449672 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000222016 Serum_albumin_N (17/174 aa) CDS Deleted
ENSMUSE00000222007 Serum_albumin_N (45/174 aa) CDS Deleted
ENSMUSE00000221996 Serum_albumin_N (71/174 aa) CDS Deleted
ENSMUSE00000221985 Serum_albumin_N (43/174 aa) CDS CDS + stop codon + UTR
ENSMUSE00000331075 Serum_albumin_N (17/169 aa) CDS
ENSMUSE00000331064 Serum_albumin_N (44/169 aa) CDS
ENSMUSE00000331052 Serum_albumin_N (68/169 aa) CDS
ENSMUSE00000331041 Serum_albumin_N (42/169 aa) CDS
ENSMUSE00000331027 VitD-bind_III (16/66 aa) CDS
ENSMUSE00000331012 VitD-bind_III (45/66 aa) CDS
ENSMUSE00000473900 VitD-bind_III (6/66 aa) CDS + stop codon + UTR
ENSMUSE00000474891 UTR UTR
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01861P1_C_178W_G4 N01861P1_T_185.5_B02 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 237490 Deletion (Promotor Driven Cassette) N01861P1_T_185.5_B02 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
237490 Deletion N01861P1_I_185.5_B02