IKMC Project Report - KOMP-CSD (ID: 66298)
Cd6 MGI:103566 ENSMUSG00000024670 OTTMUSG00000036965
Mice no data available
Mutagenesis Predictions
This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000080292 | protein_coding | Residual N-terminal, residual C-terminal product | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MWLFLGIAGLLTAVLSGLPSPAPSGQHKNGTIPNMTLDLGSQRHLNLSTSEVPSRVPVTIESSVPVSVKDKDSQGLTLLI LCIVLGILLLVSTIFIVILLLRAKGQYALPASVNHQQLSTANQAGINNYHPVPITIAKEAPMLFIQPRVPADSDSSSDSD YEHYDFSSQPPVALTTFYNSQRHRVTEEEAQQNRFQMPPLEEGLEELHVSHIPAADPRPCVADVPSRGSQYHVRNNSDSS TSSEEGYCNDPSSKPPPWNSQAFYSEKSPLTEQPPNLELAGSPAVFSGPSADDSSSTSSGEWYQNFQPPPQHPPAEQFEC PGPPGPQTDSIDDDEEDYDDIGAA*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000039043 | protein_coding | Residual N-terminal, residual C-terminal product | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MWLFLGIAGLLTAVLSGLPSPAPSGQHKNGTIPNMTLDLGSQRHLNLSTSEVPSRVPVTIESSVPVSVKDKDSQGLTLLI LCIVLGILLLVSTIFIVILLLRAKGQYALPASVNHQQLSTANQAGINNYHPVPITIAKEDSQRHRVTEEEAQQNRFQMPP LEEGLEELHVSHIPAADPRPCVADVPSRGSQYHVRNNSDSSTSSEEGYCNDPSSKPPPWNSQAFYSEKSPLTEQPPNLEL AGSPAVFSGPSADDSSSTSSGEWYQNFQPPPQHPPAEQFECPGPPGPQTDSIDDDEEDYDDIGAA*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000174176 | protein_coding | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000025572 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000173613 | retained_intron | Target region does not overlap transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones Without Conditional Potential
Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0307_1_G09 | PRPGS00129_B_G02 | Cd6tm2e(KOMP)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A1.N3 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 174496 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00129_Y_3_G02 | L1L2_Bact_P | L3L4_pZero_DTA_kan | view |
| order | 174496 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00129_Y_2_G02 | L1L2_Bact_P | L3L4_pZero_DTA_kan | view |
| order | 174496 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00129_Y_1_G02 | L1L2_Bact_P | L3L4_pZero_DTA_kan | view |
| order | 174496 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PRPGS00129_B_G02 | L1L2_Bact_P | L3L4_pZero_DTA_kan | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 174496 | Knockout First, Reporter-tagged insertion with conditional potential | PCS00129_A_G02 |