IKMC Project Report - KOMP-CSD (ID: 66298)

Cd6 MGI:103566 ENSMUSG00000024670 OTTMUSG00000036965
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000080292 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MWLFLGIAGLLTAVLSGLPSPAPSGQHKNGTIPNMTLDLGSQRHLNLSTSEVPSRVPVTIESSVPVSVKDKDSQGLTLLI
LCIVLGILLLVSTIFIVILLLRAKGQYALPASVNHQQLSTANQAGINNYHPVPITIAKEAPMLFIQPRVPADSDSSSDSD
YEHYDFSSQPPVALTTFYNSQRHRVTEEEAQQNRFQMPPLEEGLEELHVSHIPAADPRPCVADVPSRGSQYHVRNNSDSS
TSSEEGYCNDPSSKPPPWNSQAFYSEKSPLTEQPPNLELAGSPAVFSGPSADDSSSTSSGEWYQNFQPPPQHPPAEQFEC
PGPPGPQTDSIDDDEEDYDDIGAA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000901955 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000643064 CDS CDS
ENSMUSE00000643061 Srcr_rcpt (107/107 aa) CDS Deleted
ENSMUSE00000643059 Srcr_rcpt (97/97 aa) CDS Deleted
ENSMUSE00000643056 Srcr_rcpt (1/97 aa) | Srcr_rcpt (93/93 aa) CDS Deleted
ENSMUSE00001002376 Srcr_rcpt (1/93 aa) CDS CDS
ENSMUSE00000996014 CDS CDS
ENSMUSE00000963587 CDS CDS
ENSMUSE00001041280 CDS CDS
ENSMUSE00001048533 CDS CDS
ENSMUSE00001023889 CDS CDS
ENSMUSE00001071164 CDS CDS
ENSMUSE00000931896 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000039043 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MWLFLGIAGLLTAVLSGLPSPAPSGQHKNGTIPNMTLDLGSQRHLNLSTSEVPSRVPVTIESSVPVSVKDKDSQGLTLLI
LCIVLGILLLVSTIFIVILLLRAKGQYALPASVNHQQLSTANQAGINNYHPVPITIAKEDSQRHRVTEEEAQQNRFQMPP
LEEGLEELHVSHIPAADPRPCVADVPSRGSQYHVRNNSDSSTSSEEGYCNDPSSKPPPWNSQAFYSEKSPLTEQPPNLEL
AGSPAVFSGPSADDSSSTSSGEWYQNFQPPPQHPPAEQFECPGPPGPQTDSIDDDEEDYDDIGAA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000935715 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000643064 CDS CDS
ENSMUSE00000643061 Srcr_rcpt (107/107 aa) CDS Deleted
ENSMUSE00000643059 Srcr_rcpt (97/97 aa) CDS Deleted
ENSMUSE00000643056 Srcr_rcpt (1/97 aa) | Srcr_rcpt (93/93 aa) CDS Deleted
ENSMUSE00001002376 Srcr_rcpt (1/93 aa) CDS CDS
ENSMUSE00000996014 CDS CDS
ENSMUSE00000963587 CDS CDS
ENSMUSE00001048533 CDS CDS
ENSMUSE00001023889 CDS CDS
ENSMUSE00001071164 CDS CDS
ENSMUSE00000928140 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000174176 protein_coding No analysis available: incomplete transcript
ENSMUST00000025572 retained_intron No analysis available: incomplete transcript
ENSMUST00000173613 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0307_1_G09 PRPGS00129_B_G02 Cd6tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 174496 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00129_Y_3_G02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 174496 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00129_Y_2_G02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 174496 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00129_Y_1_G02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 174496 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00129_B_G02 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
174496 Knockout First, Reporter-tagged insertion with conditional potential PCS00129_A_G02