IKMC Project Report - KOMP-CSD (ID: 66383)

Lrriq1 MGI:1922228 ENSMUSG00000019892 OTTMUSG00000032477
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000020043 protein_coding No protein product (NMD) view

Predicted translation:

MEDSDDSEAKLREEIEAELDKISISSLENDEVENDSVSDTQSDSSDTDLLELPESVLHYINVIKNKSKTAEELILQDVED
TDIFSDYKKDIICNRKGRIYEKSSSFCQVCFRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000098851 UTR UTR
ENSMUSE00000098850 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000098844 CDS CDS
ENSMUSE00000098842 CDS Deleted
ENSMUSE00000098840 CDS CDS + stop codon + UTR
ENSMUSE00000098841 CDS
ENSMUSE00000098846 CDS
ENSMUSE00000640682 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166240 protein_coding No protein product (NMD) view

Predicted translation:

MEDSDDSEAKLREEIEAELDKISISSLENDEVENDSVSDTQSDSSDTDLLELPESVLHYINVIKNKSKTAEELILQDVED
TDIFSDYKKDIICNRKGRIYEKSSSFCQVCFRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000098851 UTR UTR
ENSMUSE00000098850 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000098844 CDS CDS
ENSMUSE00000098842 CDS Deleted
ENSMUSE00000098840 CDS CDS + stop codon + UTR
ENSMUSE00000098841 CDS
ENSMUSE00000098846 CDS
ENSMUSE00000892300 CDS
ENSMUSE00000904046 CDS
ENSMUSE00000881075 Leu-rich_rpt (15/21 aa) CDS
ENSMUSE00000902399 Leu-rich_rpt (7/21 aa) CDS
ENSMUSE00000882812 CDS
ENSMUSE00000884880 CDS
ENSMUSE00000894305 CDS
ENSMUSE00000878253 CDS
ENSMUSE00000912410 CDS
ENSMUSE00000899662 IQ_motif_EF-hand-BS (19/19 aa) | IQ_motif_EF-hand-BS (7/19 aa) CDS
ENSMUSE00000873346 IQ_motif_EF-hand-BS (12/19 aa) CDS
ENSMUSE00000894506 CDS
ENSMUSE00000912682 CDS
ENSMUSE00000884295 CDS
ENSMUSE00000894442 CDS
ENSMUSE00000874845 CDS
ENSMUSE00000907529 CDS
ENSMUSE00000878840 CDS
ENSMUSE00000879482 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000123364 protein_coding No protein product (NMD) view

Predicted translation:

MEDSDDSEAKLREEIEAELDKISISSLENDEVENDSVSDTQSDSSDTDLLELPESVLHYINVIKNKSKTAEELILQDVED
TDIFSDYKKDIICNRKGRIYEKSSSFCQVCFRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000772389 UTR UTR
ENSMUSE00000098850 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000098844 CDS CDS
ENSMUSE00000098842 CDS Deleted
ENSMUSE00000098840 CDS CDS + stop codon + UTR
ENSMUSE00000098841 CDS
ENSMUSE00000098846 CDS
ENSMUSE00000782103 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available