IKMC Project Report - EUCOMM (ID: 66600)

Atrn MGI:1341628 ENSMUSG00000027312 OTTMUSG00000015539
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000028781 protein_coding No protein product (NMD) view

Predicted translation:

MVAVAAAAATEARLRGSTTATAAPAGRKGRQHRPCTATGAWRPGPRARLCLPRVLSRALPPPPLLPLLFSLLLLPLPREA
EAAAVAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPTGWVGEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWL
IEGQPNRIMRLRFNHFATECSWDHLYVYDGDSIYAPLIAAFRSWMLNSCAS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000821367 CUB (5/114 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000974556 CUB (29/114 aa) CDS CDS
ENSMUSE00000970163 CUB (39/114 aa) CDS CDS
ENSMUSE00001086586 CUB (44/114 aa) CDS Deleted
ENSMUSE00001045108 CUB (1/114 aa) CDS Deleted
ENSMUSE00000967469 Kelch_1 (31/41 aa) CDS CDS + stop codon + UTR
ENSMUSE00001035443 Kelch_1 (11/41 aa) CDS
ENSMUSE00001066826 CDS
ENSMUSE00001033739 CDS
ENSMUSE00001046822 CDS
ENSMUSE00000999061 CDS
ENSMUSE00001034503 CDS
ENSMUSE00001084340 Plexin_repeat (35/46 aa) CDS
ENSMUSE00001069148 Plexin_repeat (11/46 aa) CDS
ENSMUSE00000967189 CDS
ENSMUSE00001001137 CDS
ENSMUSE00001071474 Plexin_repeat (51/51 aa) CDS
ENSMUSE00000980017 Plexin_repeat (1/51 aa) | Plexin_repeat (76/76 aa) CDS
ENSMUSE00001006974 Plexin_repeat (1/76 aa) CDS
ENSMUSE00001019432 CDS
ENSMUSE00001031713 CDS
ENSMUSE00000966332 CDS
ENSMUSE00001024582 CDS
ENSMUSE00000168275 CDS
ENSMUSE00000168290 CDS
ENSMUSE00000558677 CDS
ENSMUSE00000257707 CDS
ENSMUSE00000257702 CDS
ENSMUSE00000596428 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000134964 retained_intron No analysis available: incomplete transcript
ENSMUST00000151364 retained_intron Target region does not overlap transcript
ENSMUST00000132557 retained_intron Target region does not overlap transcript
ENSMUST00000156982 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available