IKMC Project Report - (ID: 66751)

non-BioMart die(): Cannot write to '/nfs/team87/services/biomart/ikmc-mart/production/server/releases/20110531105342/logs/log4perl_log': at /software/team87/brave_new_world/lib/perl5/Log/Log4perl/Appender/File.pm line 245.
Pre-pipeline Designs Vectors ES Cells Mice

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000072235 protein_coding No protein product (NMD) view

Predicted translation:

MAGAGSNGETLATRMEIIEMNDKLRNRQEIVNGLNIFLEENGGRN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000367133 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000155725 CDS CDS
ENSMUSE00000299408 CDS Deleted
ENSMUSE00000155729 CDS CDS + stop codon + UTR
ENSMUSE00000155730 CDS
ENSMUSE00000408941 CDS
ENSMUSE00000481523 CDS
ENSMUSE00000699511 CDS
ENSMUSE00000333374 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available