IKMC Project Report - KOMP-CSD (ID: 69083)

Jak3 MGI:99928 ENSMUSG00000031805 OTTMUSG00000021111
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000051995 protein_coding No protein product (NMD) view

Predicted translation:

MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKACAFPDLL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000682378 UTR UTR
ENSMUSE00001087047 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001004544 CDS Deleted
ENSMUSE00001006480 CDS Deleted
ENSMUSE00000995935 CDS Deleted
ENSMUSE00000328693 CDS Deleted
ENSMUSE00000329361 CDS CDS + stop codon + UTR
ENSMUSE00000329356 CDS
ENSMUSE00000329342 CDS
ENSMUSE00001024276 CDS
ENSMUSE00001090540 Ser-Thr/Tyr_kinase_cat_dom (2/257 aa) CDS
ENSMUSE00000995061 Ser-Thr/Tyr_kinase_cat_dom (44/257 aa) | Prot_kinase_cat_dom (44/253 aa) CDS
ENSMUSE00000997084 Ser-Thr/Tyr_kinase_cat_dom (29/257 aa) | Prot_kinase_cat_dom (29/253 aa) CDS
ENSMUSE00000984435 Ser-Thr/Tyr_kinase_cat_dom (43/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00000988802 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (45/253 aa) CDS
ENSMUSE00001078173 Ser-Thr/Tyr_kinase_cat_dom (51/257 aa) | Prot_kinase_cat_dom (51/253 aa) CDS
ENSMUSE00001032852 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00001061223 Ser-Thr/Tyr_kinase_cat_dom (7/272 aa) | Prot_kinase_cat_dom (5/264 aa) CDS
ENSMUSE00001037435 Ser-Thr/Tyr_kinase_cat_dom (64/272 aa) | Prot_kinase_cat_dom (64/264 aa) CDS
ENSMUSE00001072401 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/264 aa) CDS
ENSMUSE00001019221 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/264 aa) CDS
ENSMUSE00000980968 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/264 aa) CDS
ENSMUSE00001074812 Ser-Thr/Tyr_kinase_cat_dom (37/272 aa) | Prot_kinase_cat_dom (37/264 aa) CDS
ENSMUSE00001001023 Ser-Thr/Tyr_kinase_cat_dom (26/272 aa) | Prot_kinase_cat_dom (20/264 aa) CDS + stop codon + UTR
ENSMUSE00001082089 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000110013 protein_coding No protein product (NMD) view

Predicted translation:

MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKACAFPDLL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000682378 UTR UTR
ENSMUSE00001087047 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001004544 CDS Deleted
ENSMUSE00001006480 CDS Deleted
ENSMUSE00000995935 CDS Deleted
ENSMUSE00000328693 CDS Deleted
ENSMUSE00000329361 CDS CDS + stop codon + UTR
ENSMUSE00000329356 CDS
ENSMUSE00000329342 CDS
ENSMUSE00001024276 CDS
ENSMUSE00001090540 Ser-Thr/Tyr_kinase_cat_dom (2/257 aa) CDS
ENSMUSE00000995061 Ser-Thr/Tyr_kinase_cat_dom (44/257 aa) | Prot_kinase_cat_dom (44/253 aa) CDS
ENSMUSE00000997084 Ser-Thr/Tyr_kinase_cat_dom (29/257 aa) | Prot_kinase_cat_dom (29/253 aa) CDS
ENSMUSE00000984435 Ser-Thr/Tyr_kinase_cat_dom (43/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00000988802 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (45/253 aa) CDS
ENSMUSE00001078173 Ser-Thr/Tyr_kinase_cat_dom (51/257 aa) | Prot_kinase_cat_dom (51/253 aa) CDS
ENSMUSE00001032852 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00001061223 Ser-Thr/Tyr_kinase_cat_dom (7/272 aa) | Prot_kinase_cat_dom (5/264 aa) CDS
ENSMUSE00001037435 Ser-Thr/Tyr_kinase_cat_dom (64/272 aa) | Prot_kinase_cat_dom (64/264 aa) CDS
ENSMUSE00001072401 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/264 aa) CDS
ENSMUSE00001019221 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/264 aa) CDS
ENSMUSE00000980968 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/264 aa) CDS
ENSMUSE00001074812 Ser-Thr/Tyr_kinase_cat_dom (37/272 aa) | Prot_kinase_cat_dom (37/264 aa) CDS
ENSMUSE00000682376 Ser-Thr/Tyr_kinase_cat_dom (26/272 aa) | Prot_kinase_cat_dom (20/264 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000110012 protein_coding No protein product (NMD) view

Predicted translation:

MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKACAFPDLL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000682370 UTR UTR
ENSMUSE00001087047 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001004544 CDS Deleted
ENSMUSE00001006480 CDS Deleted
ENSMUSE00000995935 CDS Deleted
ENSMUSE00000328693 CDS Deleted
ENSMUSE00000329361 CDS CDS + stop codon + UTR
ENSMUSE00000329356 CDS
ENSMUSE00000329342 CDS
ENSMUSE00001024276 CDS
ENSMUSE00001090540 Ser-Thr/Tyr_kinase_cat_dom (2/257 aa) CDS
ENSMUSE00000995061 Ser-Thr/Tyr_kinase_cat_dom (44/257 aa) | Prot_kinase_cat_dom (44/253 aa) CDS
ENSMUSE00000997084 Ser-Thr/Tyr_kinase_cat_dom (29/257 aa) | Prot_kinase_cat_dom (29/253 aa) CDS
ENSMUSE00000984435 Ser-Thr/Tyr_kinase_cat_dom (43/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00000988802 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (45/253 aa) CDS
ENSMUSE00001078173 Ser-Thr/Tyr_kinase_cat_dom (51/257 aa) | Prot_kinase_cat_dom (51/253 aa) CDS
ENSMUSE00001032852 Ser-Thr/Tyr_kinase_cat_dom (45/257 aa) | Prot_kinase_cat_dom (43/253 aa) CDS
ENSMUSE00001061223 Ser-Thr/Tyr_kinase_cat_dom (7/272 aa) | Prot_kinase_cat_dom (5/264 aa) CDS
ENSMUSE00001037435 Ser-Thr/Tyr_kinase_cat_dom (64/272 aa) | Prot_kinase_cat_dom (64/264 aa) CDS
ENSMUSE00001072401 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/264 aa) CDS
ENSMUSE00001019221 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/264 aa) CDS
ENSMUSE00000980968 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/264 aa) CDS
ENSMUSE00001074812 Ser-Thr/Tyr_kinase_cat_dom (37/272 aa) | Prot_kinase_cat_dom (37/264 aa) CDS
ENSMUSE00000682369 Ser-Thr/Tyr_kinase_cat_dom (26/272 aa) | Prot_kinase_cat_dom (20/264 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000130624 retained_intron No analysis available: incomplete transcript
ENSMUST00000133263 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order DEPD00505_6_A05 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_E06 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_D08 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_H06 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_E07 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_C05 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_B06 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_D06 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_A08 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_F05 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order DEPD00505_6_C06 DPGS00179_A_C09 Jak3tm1(KOMP)Mbp Deletion (Promotor Driven Cassette) JM8A3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen - 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 236826 Deletion (Promotor Driven Cassette) PG00179_Z_7_C09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236826 Deletion (Promotor Driven Cassette) PG00179_Z_5_C09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236826 Deletion (Promotor Driven Cassette) PG00179_Z_8_D09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236826 Deletion (Promotor Driven Cassette) PG00179_Z_8_C09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236826 Deletion (Promotor Driven Cassette) PG00179_Z_3_C09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236826 Deletion (Promotor Driven Cassette) PG00179_Z_3_D09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236826 Deletion (Promotor Driven Cassette) DPGS00179_A_C09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 236826 Deletion (Promotor Driven Cassette) PG00179_Z_1_C09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
236826 Deletion PCS00179_A_C09