IKMC Project Report - KOMP-CSD (ID: 69096)

Iba57 MGI:3041174 ENSMUSG00000049287 OTTMUSG00000005782
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000054523 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MAAVALLRGAAVGRRSPAWHWRLSGTASHCLARGFGLLGSNPADGVAWTCFRLDGRALVRVRGPDAAPFLLGLSTNELPL
SGPPTGAAQPSARAAYAHFLNVQGRTLYDVILYG

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000356768 GCV_T_N (59/196 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000381321 GCV_T_N (115/196 aa) CDS Deleted
ENSMUSE00000652974 GCV_T_N (24/196 aa) | GCV_T_C (79/79 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000137433 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MAAVALLRGAAVGRRSPAWHWRLSGTASHCLARGFGLLGSNPADGVAWTCFRLDGRALVRVRGPDAAPFLLGLSTNELPL
SGPPTGAAQPSARAAYAHFLNVQGRTLYDVILYG

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000772890 GCV_T_N (59/62 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000774452 GCV_T_N (4/62 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000069631 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MSHGRHPGCASYLHRALCLGPQPVKSEASGVIFKMGASALSLPPHFLERFR

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000442199 UTR + start codon + CDS
ENSMUSE00000442194 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available