IKMC Project Report - KOMP-CSD (ID: 69150)

Rgcc MGI:1913464 ENSMUSG00000022018 OTTMUSG00000042059
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
currently unavailable Genotype confirmed Rgcctm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) EPD0319_2_E12 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI/UCD
Southern Blot na TV Backbone Assay pass 5' LR-PCR fail
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation na 3' LR-PCR
Genotyping Comment -
currently unavailable Genotype confirmed Rgcctm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) EPD0319_2_H12 C57BL/6N-Atm1Brd/a view
( about ) 		UCD
Southern Blot na TV Backbone Assay na 5' LR-PCR pass
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation na 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000022595 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MKPPSAQSSPAAVAAAAKLGDTKELEDFIADLDRTLASM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000647252 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000122954 CDS Deleted
ENSMUSE00000122957 CDS Deleted
ENSMUSE00000296193 CDS CDS
ENSMUSE00000685647 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0319_2_H12 DPGS00142_B_B12 Rgcctm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A1.N3 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype 0.7 - 0.61 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0319_2_E12 DPGS00142_B_B12 Rgcctm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A1.N3 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0319_2_F11 DPGS00142_B_B12 Rgcctm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.2 - 0.11 Copy Number fail Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0319_2_H11 DPGS00142_B_B12 Rgcctm1(KOMP)Wtsi Deletion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 210835 Deletion (Promotor Driven Cassette) PG00142_Y_4_B12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 210835 Deletion (Promotor Driven Cassette) PG00142_Y_2_B12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 210835 Deletion (Promotor Driven Cassette) PG00142_Y_1_B12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 210835 Deletion (Promotor Driven Cassette) PG00142_Y_3_B12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 210835 Deletion (Promotor Driven Cassette) DPGS00142_B_B12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 210835 Deletion (Promotor Driven Cassette) PG00142_Y_3_A12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
210835 Deletion PCS00142_A_B12