IKMC Project Report - KOMP-CSD (ID: 69156)

Enox1 MGI:2444896 ENSMUSG00000022012
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000022589 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MVDAAGFESVAQCPRELHQMMAAAADGLGSIALDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSDDSKFSEAITV
LLSWIERGEVNRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIVAVFNASTRQKAWDHF
SKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDESALAAQAYALKEENDSLRWQLDAYRN
EVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLAIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKDL
VETNGHSHEDANEINVLTVALVNQDRENNTEKRSQGLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANE
IEMLLMRLPRMFKQEFTGVGATLEKRWKLCAFEGIKTT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000685758 UTR UTR
ENSMUSE00000685757 UTR UTR
ENSMUSE00000685756 UTR UTR
ENSMUSE00000613174 UTR UTR
ENSMUSE00000465538 UTR UTR
ENSMUSE00000466646 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000456454 CDS CDS
ENSMUSE00000274948 CDS Deleted
ENSMUSE00000122909 RRM_dom (53/56 aa) CDS Deleted
ENSMUSE00000122906 RRM_dom (4/56 aa) CDS Deleted
ENSMUSE00000456424 CDS CDS
ENSMUSE00000456416 CDS CDS
ENSMUSE00000456411 CDS CDS
ENSMUSE00000456405 CDS CDS
ENSMUSE00000274900 CDS CDS
ENSMUSE00000274894 CDS CDS
ENSMUSE00000274887 CDS CDS
ENSMUSE00000456376 CDS CDS
ENSMUSE00000506066 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available