IKMC Project Report - KOMP-CSD (ID: 69279)

0610010F05Rik MGI:1918925 ENSMUSG00000042208 OTTMUSG00000005276
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Microinjection in progress

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000043356 protein_coding No protein product (NMD) view

Predicted translation: 

MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKECVKRFDELKSCGSSPVDNQYNPLMATGEGP
VETLATYIKSSLLDTQGDFQETPVDQDTVSKAGRHSIATTRNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKE
DFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPGNVISILISSEFLKM
DSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001074010 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001026890 CDS CDS
ENSMUSE00001069154 CDS CDS
ENSMUSE00001070576 DUF3342 (77/303 aa) CDS CDS
ENSMUSE00001035094 DUF3342 (20/303 aa) CDS CDS
ENSMUSE00000964412 DUF3342 (54/303 aa) CDS Deleted
ENSMUSE00001042656 DUF3342 (30/303 aa) CDS CDS + stop codon + UTR
ENSMUSE00001003660 DUF3342 (38/303 aa) CDS
ENSMUSE00001080203 DUF3342 (42/303 aa) CDS
ENSMUSE00001057832 DUF3342 (46/303 aa) CDS
ENSMUSE00000986269 CDS
ENSMUSE00000998365 CDS
ENSMUSE00001091425 CDS
ENSMUSE00001001779 CDS
ENSMUSE00000992892 CDS
ENSMUSE00001002889 CDS
ENSMUSE00001051032 CDS
ENSMUSE00001006318 CDS
ENSMUSE00001001582 CDS
ENSMUSE00000103075 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000180260 protein_coding No protein product (NMD) view

Predicted translation: 

MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKECVKRFDELKSCGSSPVDNQYNPLMATGEGP
VETLATYIKSSLLDTQGDFQETPVDQDTVSKAGRHSIATTRNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKE
DFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPGNVISILISSEFLKM
DSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000680653 UTR UTR
ENSMUSE00000680652 UTR UTR
ENSMUSE00001004715 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001026890 CDS CDS
ENSMUSE00001069154 CDS CDS
ENSMUSE00001070576 DUF3342 (77/303 aa) CDS CDS
ENSMUSE00001035094 DUF3342 (20/303 aa) CDS CDS
ENSMUSE00000964412 DUF3342 (54/303 aa) CDS Deleted
ENSMUSE00001042656 DUF3342 (30/303 aa) CDS CDS + stop codon + UTR
ENSMUSE00001003660 DUF3342 (38/303 aa) CDS
ENSMUSE00001080203 DUF3342 (42/303 aa) CDS
ENSMUSE00001057832 DUF3342 (46/303 aa) CDS
ENSMUSE00000986269 CDS
ENSMUSE00000998365 CDS
ENSMUSE00001091425 CDS
ENSMUSE00001001779 CDS
ENSMUSE00000992892 CDS
ENSMUSE00001002889 CDS
ENSMUSE00001051032 CDS
ENSMUSE00001006318 CDS
ENSMUSE00001001582 CDS
ENSMUSE00000915333 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000109532 protein_coding No protein product (NMD) view

Predicted translation: 

MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKECVKRFDELKSCGSSPVDNQYNPLMATGEGP
VETLATYIKSSLLDTQGDFQETPVDQDTVSKAGRHSIATTRNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKE
DFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPGNVISILISSEFLKM
DSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000874408 UTR UTR
ENSMUSE00000873209 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001026890 CDS CDS
ENSMUSE00001069154 CDS CDS
ENSMUSE00001070576 DUF3342 (77/303 aa) CDS CDS
ENSMUSE00001035094 DUF3342 (20/303 aa) CDS CDS
ENSMUSE00000964412 DUF3342 (54/303 aa) CDS Deleted
ENSMUSE00001042656 DUF3342 (30/303 aa) CDS CDS + stop codon + UTR
ENSMUSE00001003660 DUF3342 (38/303 aa) CDS
ENSMUSE00001080203 DUF3342 (42/303 aa) CDS
ENSMUSE00001057832 DUF3342 (46/303 aa) CDS
ENSMUSE00000986269 CDS
ENSMUSE00000998365 CDS
ENSMUSE00001091425 CDS
ENSMUSE00001001779 CDS
ENSMUSE00000992892 CDS
ENSMUSE00001002889 CDS
ENSMUSE00001051032 CDS
ENSMUSE00001006318 CDS
ENSMUSE00001001582 CDS
ENSMUSE00000915333 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000093267 protein_coding No protein product (NMD) view

Predicted translation: 

MVIHVCDEAKSLKEDFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPG
NVISILISSEFLKMDSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001082357 UTR UTR
ENSMUSE00000997222 UTR UTR
ENSMUSE00000964387 DUF3342 (77/303 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001035094 DUF3342 (20/303 aa) CDS CDS
ENSMUSE00000964412 DUF3342 (54/303 aa) CDS Deleted
ENSMUSE00001042656 DUF3342 (30/303 aa) CDS CDS + stop codon + UTR
ENSMUSE00001003660 DUF3342 (38/303 aa) CDS
ENSMUSE00001080203 DUF3342 (42/303 aa) CDS
ENSMUSE00001057832 DUF3342 (46/303 aa) CDS
ENSMUSE00000986269 CDS
ENSMUSE00000998365 CDS
ENSMUSE00001091425 CDS
ENSMUSE00001001779 CDS
ENSMUSE00000992892 CDS
ENSMUSE00001002889 CDS
ENSMUSE00001051032 CDS
ENSMUSE00001006318 CDS
ENSMUSE00001001582 CDS
ENSMUSE00000680655 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000141353 protein_coding No analysis available: incomplete transcript
ENSMUST00000131612 protein_coding Target region does not overlap transcript
ENSMUST00000123909 protein_coding Target region does not overlap transcript
ENSMUST00000155903 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0351_2_F08 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_D06 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_E07 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_D08 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_B05 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_C05 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_G06 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_E06 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_D07 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_F07 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_E08 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_C07 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_D05 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_B08 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_F06 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_C06 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_F05 PRPGS00101_C_A01 0610010F05Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0351_2_B06 PRPGS00101_C_A01 0610010F05Riktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_B07 PRPGS00101_C_A01 0610010F05Riktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_A07 PRPGS00101_C_A01 0610010F05Riktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_A05 PRPGS00101_C_A01 0610010F05Riktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_A08 PRPGS00101_C_A01 0610010F05Riktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_H06 PRPGS00101_C_A01 0610010F05Riktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0351_2_A06 PRPGS00101_C_A01 0610010F05Riktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_2_A10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_2_G09 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00101_D_A01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_B04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_2_D10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_1_G03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_C10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_1_C06 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_B02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_2_B01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_1_B07 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_2_H04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_A04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_G05 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_F04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_D11 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_H12 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_2_C05 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_B12 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_1_G06 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00101_C_A01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_G03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_D05 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_2_B04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_2_G02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_2_H12 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_G10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_2_A02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_2_B05 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_2_A10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_X_2_G03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96773 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00101_V_1_F03 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
96773 Knockout First, Reporter-tagged insertion with conditional potential PCS00101_C_A01