IKMC Project Report - KOMP-CSD (ID: 69294)

Sptssa MGI:1913399 ENSMUSG00000044408
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
currently unavailable Genotype confirmed Sptssatm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) EPD0346_5_B07 C57BL/6N;C57BL/6NJ;C57BL/6N-Atm1Brd/a view
( about ) 		JAX/
Southern Blot na TV Backbone Assay na 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) na
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation na 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000056228 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVF

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000336801 Ser_palmitoyltrfase_ssu-like (29/56 aa) UTR + start codon + CDS
ENSMUSE00000375509 Ser_palmitoyltrfase_ssu-like (28/56 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0346_5_B07 PRPGS00101_C_B05 Sptssatm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A1.N3 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.7 - 0.61 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) pass
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0346_5_G06 PRPGS00101_C_B05 Sptssatm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.9 - 0.81 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0346_5_E06 PRPGS00101_C_B05 Sptssatm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype 0.4 - 0.31 Copy Number pass Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0346_5_F07 PRPGS00101_C_B05 Sptssatm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00101_C_B05 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_F03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_D02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_A11 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_B09 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_C04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_G11 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_H04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00101_D_B05 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_F06 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_G04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_D10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_B04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_F07 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_4_F03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_E06 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_E02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_E05 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_B09 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_A04 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_H05 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_G10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_C02 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_C03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_E10 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_H09 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_V_2_C01 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 96362 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00101_X_2_E12 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
96362 Knockout-First - Reporter Tagged Insertion PCS00101_C_B05