IKMC Project Report - EUCOMM (ID: 69649)

Cystm1 MGI:1913310 ENSMUSG00000046727 OTTMUSG00000032601
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000152804 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MNPENPPPYPGPGPTAPYPPYPQQPMGPMGPMGAPPPQGYPYPPPQGYPYQGYPQYGWQGGPQEPPKTT

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000760618 UTR UTR
ENSMUSE00000892053 UTR + start codon + CDS
ENSMUSE00000788173 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000050584 protein_coding Design floxes no exons in transcript ENSMUST00000050584
ENSMUST00000144158 protein_coding Design floxes no exons in transcript ENSMUST00000144158
ENSMUST00000139727 protein_coding Target region does not overlap transcript
ENSMUST00000145439 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available